CoraLite® Plus 488-conjugated CORO1A Polyclonal antibody

CORO1A Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-17760

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

CLABP, Clipin A, CLIPINA, Clipin-A, CORO1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon tissue, mouse spleen tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17760 targets CORO1A in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12139

Product name: Recombinant human CORO1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-461 aa of BC110374

Sequence: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Predict reactive species
Full Name coronin, actin binding protein, 1A
Calculated Molecular Weight 461 aa, 51 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC110374
Gene Symbol CORO1A
Gene ID (NCBI) 11151
RRIDAB_3084008
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31146
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CORO1A also known as TACO, belongs to the WD repeat coronin family. CORO1A is recruited to phagosomes and actively retained by surviving mycobacteria and is usually released before phagosome fusion with or maturation into lysosomes. CORO1A is expressed in the brain, thymus, spleen, bone marrow, and lymph nodes. Mutations in CORO1A cause Immunodeficiency 8 with lymphoproliferation (IMD8)(PMID: 10338208).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CORO1A antibody CL488-17760Download protocol
IF protocol for CL Plus 488 CORO1A antibody CL488-17760Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...