Tested Applications
Positive WB detected in | Daudi cells, human heart tissue, mouse lung tissue, mouse spleen tissue, L02 cells, mouse kidney tissue, Ramos cells, Raji cells, rat brain tissue, mouse brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | mouse testis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 25 publications below |
IHC | See 1 publications below |
IF | See 3 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
21090-1-AP targets CHCHD4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15339 Product name: Recombinant human CHCHD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC033775 Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS Predict reactive species |
Full Name | coiled-coil-helix-coiled-coil-helix domain containing 4 |
Calculated Molecular Weight | 142 aa, 16 kDa |
Observed Molecular Weight | 22 kDa |
GenBank Accession Number | BC033775 |
Gene Symbol | CHCHD4 |
Gene ID (NCBI) | 131474 |
RRID | AB_10734583 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N4Q1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHCHD4, a component of human mitochondria, belongs to a protein family. It functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. It is required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CHCHD4 antibody 21090-1-AP | Download protocol |
IHC protocol for CHCHD4 antibody 21090-1-AP | Download protocol |
IP protocol for CHCHD4 antibody 21090-1-AP | Download protocol |
WB protocol for CHCHD4 antibody 21090-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. | ||
Exp Mol Med SIRT5-related desuccinylation modification of AIFM1 protects against compression-induced intervertebral disc degeneration by regulating mitochondrial homeostasis | ||
Redox Biol Flow-induced endothelial mitochondrial remodeling mitigates mitochondrial reactive oxygen species production and promotes mitochondrial DNA integrity in a p53-dependent manner. | ||
EMBO Mol Med A novel CHCHD10 mutation implicates a Mia40-dependent mitochondrial import deficit in ALS. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Veronica (Verified Customer) (10-17-2023) | First time I find an anti-CHCHD4 antibody that works fine. We are testing it in IF as well, but till now I am already really happy with the result in WB. No aspecific signal, clear band. Reccomended! Conditions: Gradient gel 8-15% Ab’: 1:1000 in 5% milk O/N
![]() |
FH Süleyman (Verified Customer) (01-23-2022) | CHCHD4 antibody (Green) is used 1:100 dilution (2 hour at RT) and 1:700 of Alexa Fluor 488 secondary antibody (1 hour RT). 4% Paraformaldehyde fixation for 10 min at RT. Permeabilization with 0.3% Triton X for 10-15 minutes at RT. 5% FBS in PBS used for blocking for 1 hour at RT. The image is colocalized with TOMM20 (Red). Blue is DAPI. As you can see there is colocalization with TOMM20 as CHCHD4 supposed to be in IMS but I also see unspecific bindings in cytosolic proteins. Therefore my rating is 3 as it might be binding unspecifically.
![]() |
FH Lana (Verified Customer) (08-13-2019) | SDS-PAGE: 10 ug/ul RIPA lysate of the mitochondrial fraction of HEK293t. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4CBlocking: SEA Block Blocking Buffer 1hPrimary Ab: O/N incubation at 4CSecondary Ab: IRDye 800CW Goat anti-Rabbit
![]() |