• Featured Product
  • KD/KO Validated

CHCHD4 Polyclonal antibody

CHCHD4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 21090-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

MIA40, Coiled-coil-helix-coiled-coil-helix domain-containing protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, human heart tissue, mouse lung tissue, mouse spleen tissue, L02 cells, mouse kidney tissue, Ramos cells, Raji cells, rat brain tissue, mouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse testis tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21090-1-AP targets CHCHD4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15339

Product name: Recombinant human CHCHD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC033775

Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 4
Calculated Molecular Weight 142 aa, 16 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC033775
Gene Symbol CHCHD4
Gene ID (NCBI) 131474
RRIDAB_10734583
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N4Q1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHCHD4, a component of human mitochondria, belongs to a protein family. It functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. It is required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS).

Protocols

Product Specific Protocols
IF protocol for CHCHD4 antibody 21090-1-APDownload protocol
IHC protocol for CHCHD4 antibody 21090-1-APDownload protocol
IP protocol for CHCHD4 antibody 21090-1-APDownload protocol
WB protocol for CHCHD4 antibody 21090-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Stem Cell

Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.

Authors - Rashim Pal Singh
ratWB,IF

Exp Mol Med

SIRT5-related desuccinylation modification of AIFM1 protects against compression-induced intervertebral disc degeneration by regulating mitochondrial homeostasis

Authors - Jianxin Mao
humanWB,IF

Aging Cell

Dependence of PINK1 accumulation on mitochondrial redox system.

Authors - Feng Gao
  • KD Validated
humanWB

Redox Biol

Flow-induced endothelial mitochondrial remodeling mitigates mitochondrial reactive oxygen species production and promotes mitochondrial DNA integrity in a p53-dependent manner.

Authors - Junchul Shin
humanWB

EMBO Mol Med

A novel CHCHD10 mutation implicates a Mia40-dependent mitochondrial import deficit in ALS.

Authors - Carina Lehmer
humanWB

Oncogene

CHTM1, a novel metabolic marker deregulated in human malignancies.

Authors - Mansi Babbar

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Veronica (Verified Customer) (10-17-2023)

First time I find an anti-CHCHD4 antibody that works fine. We are testing it in IF as well, but till now I am already really happy with the result in WB. No aspecific signal, clear band. Reccomended! Conditions: Gradient gel 8-15% Ab’: 1:1000 in 5% milk O/N

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T; HeLa; isolated mitochondria from HEK293T
CHCHD4 Antibody Western Blot validation (1:1000 dilution) in HEK293T; HeLa; isolated mitochondria from HEK293T (Cat no:21090-1-AP)
FH

Süleyman (Verified Customer) (01-23-2022)

CHCHD4 antibody (Green) is used 1:100 dilution (2 hour at RT) and 1:700 of Alexa Fluor 488 secondary antibody (1 hour RT). 4% Paraformaldehyde fixation for 10 min at RT. Permeabilization with 0.3% Triton X for 10-15 minutes at RT. 5% FBS in PBS used for blocking for 1 hour at RT. The image is colocalized with TOMM20 (Red). Blue is DAPI. As you can see there is colocalization with TOMM20 as CHCHD4 supposed to be in IMS but I also see unspecific bindings in cytosolic proteins. Therefore my rating is 3 as it might be binding unspecifically.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HeLa FlipIn
CHCHD4 Antibody Immunofluorescence validation (1:100 dilution) in HeLa FlipIn (Cat no:21090-1-AP)
FH

Lana (Verified Customer) (08-13-2019)

SDS-PAGE: 10 ug/ul RIPA lysate of the mitochondrial fraction of HEK293t. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4CBlocking: SEA Block Blocking Buffer 1hPrimary Ab: O/N incubation at 4CSecondary Ab: IRDye 800CW Goat anti-Rabbit

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293t
CHCHD4 Antibody Western Blot, validation (1:1000 dilution) in HEK293t (Cat no:21090-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...