• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CFLAR/FLIP Polyclonal antibody

CFLAR/FLIP Polyclonal Antibody for IF/ICC
Cat No. CL488-10394

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

c FLIP, c FLIPL, c FLIPR, c FLIPS, CASH, CASP8AP1, Caspase eight related protein, Caspase homolog, Casper, CFLAR, CLARP, FLAME, FLAME 1, FLAME1, FLIP, I FLICE, Inhibitor of FLICE, MRIT, Usurpin

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10394 targets CFLAR/FLIP in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0593

Product name: Recombinant human CFLAR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-184 aa of BC001602

Sequence: DVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRN

Predict reactive species
Full Name CASP8 and FADD-like apoptosis regulator
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 20-35 kDa, 50-55 kDa
GenBank Accession NumberBC001602
Gene Symbol FLIP
Gene ID (NCBI) 8837
RRIDAB_3672439
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15519
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CFLAR, also named CASH, CASP8AP1, CLARP, MRIT, Casper, c-FLIP, and I-FLICE, belongs to the peptidase C14A family. It is an apoptosis regulator protein that may function as a crucial link between cell survival and cell death pathways in mammalian cells. CFLAR acts as an inhibitor of TNFRSF6-mediated apoptosis. It can be cleaved to be 2 fragments P43 and P12. P43 is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full-length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. CFLAR lacks enzymatic (caspase) activity.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CFLAR/FLIP antibody CL488-10394Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...