Tested Applications
Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
CL594-18470 targets CD133 in IF-P applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13328 Product name: Recombinant human CD133 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 806-856 aa of BC012089 Sequence: LAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH Predict reactive species |
Full Name | prominin 1 |
Calculated Molecular Weight | 97 kDa |
Observed Molecular Weight | |
GenBank Accession Number | BC012089 |
Gene Symbol | CD133 |
Gene ID (NCBI) | 8842 |
RRID | AB_2919847 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43490 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 CD133 antibody CL594-18470 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |