• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated C1QBP Polyclonal antibody

C1QBP Polyclonal Antibody for IF/ICC
Cat No. CL555-24474

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

C1QBP, gC1Q R, GC1q R protein, GC1QBP, gC1qR, Glycoprotein gC1qBP, HABP1, Hyaluronan binding protein 1, p32, p33, SF2p32

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-24474 targets C1QBP in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19773

Product name: Recombinant human C1QBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-282 aa of BC013731

Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Predict reactive species
Full Name complement component 1, q subcomponent binding protein
Calculated Molecular Weight 282 aa, 31 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC013731
Gene Symbol C1QBP
Gene ID (NCBI) 708
RRIDAB_2919643
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07021
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

C1QBP, also named as gC1q receptor (gC1qR), p32, p33, and hyaluronan-binding protein 1 (HABP1), is a protein initially copurified with splicing factor SF2 (PMID: 1830244). The protein is synthesized as a pro-protein of 282 amino acids (aa) that is post-translationally processed by removal of the initial 73 aa to a mature protein of 209 aa (PMID: 8262387). C1QBP is an evolutionary conserved and ubiquitously expressed multifunctional protein and has been reported to be a predominantly mitochondrial matrix protein involved in inflammation and infection processes, mitochondrial ribosome biogenesis, regulation of apoptosis and nuclear transcription, and pre-mRNA splicing (PMID: 28942965).

Protocols

Product Specific Protocols
IF protocol for CL555 C1QBP antibody CL555-24474Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...