Tested Applications
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MDCK cells, hTERT-RPE1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 2 publications below |
Product Information
24338-1-AP targets IFT43 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19434 Product name: Recombinant human C14orf179 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-213 aa of BC010436 Sequence: MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT Predict reactive species |
| Full Name | chromosome 14 open reading frame 179 |
| Calculated Molecular Weight | 213 aa, 24 kDa |
| GenBank Accession Number | BC010436 |
| Gene Symbol | IFT43 |
| Gene ID (NCBI) | 112752 |
| RRID | AB_2749824 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96FT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IFT43, encoded by C14ORF179, is a subunit of the intraflagellar transport complex A (IFT-A) of primary cilia. The IFT-A is implicated in retrograde ciliary transport along axonemal microtubules. Defects in subunits of IFT-A has been associated with skeletal ciliopathies, including Sensenbrenner syndrome, Jeune syndrome, and Ellis-van-Creveld syndrome. Mutations in C14ORF179 has been linked to Sensenbrenner syndrome. (21378380)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFT43 antibody 24338-1-AP | Download protocol |
| IHC protocol for IFT43 antibody 24338-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Primary cilia signaling mediates intraocular pressure sensation. | ||
Elife Dynein-2 intermediate chains play crucial but distinct roles in primary cilia formation and function. | ||
Hum Mol Genet Ift172 conditional knock-out mice exhibit rapid retinal degeneration and protein trafficking defects. | ||
J Cell Physiol Ttc39c is upregulated during skeletal muscle atrophy and modulates ERK1/2 MAP kinase and hedgehog signaling. |







