IFT43 Polyclonal antibody

IFT43 Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 24338-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, canine and More (1)

Applications

WB, IHC, IF/ICC, ELISA

C14orf179, Intraflagellar transport protein 43 homolog, Intraflagellar transport protein 43 homolog isoform X2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMDCK cells, hTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24338-1-AP targets IFT43 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19434

Product name: Recombinant human C14orf179 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-213 aa of BC010436

Sequence: MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT

Predict reactive species
Full Name chromosome 14 open reading frame 179
Calculated Molecular Weight 213 aa, 24 kDa
GenBank Accession NumberBC010436
Gene Symbol IFT43
Gene ID (NCBI) 112752
RRIDAB_2749824
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96FT9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFT43, encoded by C14ORF179, is a subunit of the intraflagellar transport complex A (IFT-A) of primary cilia. The IFT-A is implicated in retrograde ciliary transport along axonemal microtubules. Defects in subunits of IFT-A has been associated with skeletal ciliopathies, including Sensenbrenner syndrome, Jeune syndrome, and Ellis-van-Creveld syndrome. Mutations in C14ORF179 has been linked to Sensenbrenner syndrome. (21378380)

Protocols

Product Specific Protocols
IF protocol for IFT43 antibody 24338-1-APDownload protocol
IHC protocol for IFT43 antibody 24338-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Brain

De novo purine biosynthesis is a major driver of chemoresistance in glioblastoma.

Authors - Jack M Shireman
mouseIF

Proc Natl Acad Sci U S A

Primary cilia signaling mediates intraocular pressure sensation.

Authors - Na Luo
humanIF

Elife

Dynein-2 intermediate chains play crucial but distinct roles in primary cilia formation and function.

Authors - Laura Vuolo
mouse

Hum Mol Genet

Ift172 conditional knock-out mice exhibit rapid retinal degeneration and protein trafficking defects.

Authors - Priya R Gupta
mouseWB

J Cell Physiol

Ttc39c is upregulated during skeletal muscle atrophy and modulates ERK1/2 MAP kinase and hedgehog signaling.

Authors - Caleb S Hayes
Loading...
||
New chat Able
正在加载,请稍候...