CoraLite® Plus 488-conjugated BCL2 Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL488-60178

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488-conjugated BCL2 antibody (CL488-60178, Clone: 4H8C6 ) at dilution of 1:100.

• 

  IF Staining of human tonsillitis using CL488-60178

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CoraLite® Plus 488-conjugated BCL2 antibody (CL488-60178, Clone: 4H8C6 ) at dilution of 1:100.

• 

  IF Staining of human appendicitis using CL488-60178

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using CoraLite® Plus 488 BCL2 antibody (CL488-60178, Clone: 4H8C6 ) at dilution of 1:200.

• 

  IF Staining of human appendicitis using CL488-60178

  Immunofluorescent analysis of (4% PFA) fixed human appendicitis tissue using CoraLite® Plus 488 BCL2 antibody (CL488-60178, Clone: 4H8C6 ) at dilution of 1:200.

• 

  IF Staining of MCF-7 using CL488-60178

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite® Plus 488 BCL2 antibody (CL488-60178, Clone: 4H8C6 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

BCL2 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL488-60178

Clone No.4H8C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

IF/ICC, IF-P

Synonyms

BCL-2, 4H8C6

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue, human appendicitis tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60178 targets BCL2 in IF/ICC, IF-P applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3508

  Product name: Recombinant human BCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC027258

  Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

• Full Name: B-cell CLL/lymphoma 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC027258
• Gene Symbol: BCL2
• Gene ID (NCBI): 596
• RRID: AB_2883111
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10415
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

BCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability. It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).