Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

BCL2 Monoclonal antibody

BCL2 Monoclonal Antibody for IHC, IHC-Autostainer, IF/ICC, IF-P, IP, ELISA

Cat No. 60178-1-Ig
Clone No.4H8C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig and More (4)

Applications

IHC, IHC-Autostainer, IF/ICC, IF-P, IP, CoIP, ELISA

BCL-2, 4H8C6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IP detected inU-937 cells
Positive IHC-Autostainer detected inhuman small intestine tissue, human lymphoma tissue, human tonsillitis tissue
Positive IHC detected inhuman tonsillitis tissue, human appendicitis tissue, human lymphoma tissue, Jurkat cells
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman appendicitis tissue, human tonsillitis tissue
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:2500-1:10000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60178-1-Ig targets BCL2 in IHC, IHC-Autostainer, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, pig, rabbit, monkey, bovine, hamster
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3508

Product name: Recombinant human BCL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC027258

Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell CLL/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC027258
Gene Symbol BCL2
Gene ID (NCBI) 596
RRIDAB_10734459
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10415
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1) What is Bcl-2?
Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.
2) FAQs for Bcl-2

A) How to measure Bcl-2 and Bax apoptotic markers by western blotting
Generally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.
B) What band size should I expect in western blotting for Bcl-2?
The molecular weight of Bcl-2 is 26 kDa.

Protocols

Product Specific Protocols
IF protocol for BCL2 antibody 60178-1-IgDownload protocol
IHC protocol for BCL2 antibody 60178-1-IgDownload protocol
IP protocol for BCL2 antibody 60178-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
human

Signal Transduct Target Ther

Inducible CD147 up-regulation boosts extended SARS-CoV-2 infection triggering severe COVID-19 independent of ACE2.

Authors - Ke Wang
human

J Extracell Vesicles

Extracellular vesicles derived from oesophageal cancer containing P4HB promote muscle wasting via regulating PHGDH/Bcl-2/caspase-3 pathway.

Authors - Xiaohan Gao
human

Autophagy

TSPAN1 promotes autophagy flux and mediates cooperation between WNT-CTNNB1 signaling and autophagy via the MIR454-FAM83A-TSPAN1 axis in pancreatic cancer.

Authors - Cefan Zhou
human

Autophagy

Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy

Authors - Kui Wang
monkeyCoIP

Autophagy

Bunyavirus SFTSV exploits autophagic flux for viral assembly and egress

Authors - Jia-min Yan
humanIHC

Nat Commun

Integrative proteogenomic characterization reveals therapeutic targets in poorly differentiated and anaplastic thyroid cancers

Authors - Zongfu Pan
Loading...
||
New chat

Able™

正在加载,请稍候...