• Featured Product
  • KD/KO Validated

BCL2 Monoclonal antibody, PBS Only (Capture)

BCL2 Monoclonal Antibody for IHC, IF/ICC, IF-P, IP, Cytometric bead array, Indirect ELISA
Cat No. 60178-1-PBS
Clone No.4H8C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

IHC, IF/ICC, IF-P, IP, Cytometric bead array, Indirect ELISA

BCL-2, 4H8C6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60178-1-PBS targets BCL2 as part of a matched antibody pair:

MP50290-2: 60178-1-PBS capture and 60178-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3508

Product name: Recombinant human BCL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC027258

Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell CLL/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC027258
Gene Symbol BCL2
Gene ID (NCBI) 596
RRIDAB_10734459
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10415
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

1) What is Bcl-2?
Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.
2) FAQs for Bcl-2

A) How to measure Bcl-2 and Bax apoptotic markers by western blotting
Generally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.
B) What band size should I expect in western blotting for Bcl-2?
The molecular weight of Bcl-2 is 26 kDa.

Loading...
||
New chat Able
正在加载,请稍候...