CoraLite®594-conjugated ATG16L1 Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-67943

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using CoraLite®594 ATG16L1 antibody (CL594-67943, Clone: 1G5G7 ) at dilution of 1:200.

ATG16L1 Monoclonal Antibody for IF/ICC

Cat No. CL594-67943

Clone No.1G5G7

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF/ICC

Synonyms

APG16 like 1, APG16L, ATG16L, ATG16L1, Autophagy related protein 16 1, FLJ00045, FLJ10035, FLJ10828, FLJ22677, IBD10, WDR30

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67943 targets ATG16L1 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14881

  Product name: Recombinant human ATG16L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 258-607 aa of BC000061

  Sequence: RAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDAHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

• Full Name: ATG16 autophagy related 16-like 1 (S. cerevisiae)
• Calculated Molecular Weight: 607 aa, 68 kDa
• Observed Molecular Weight: 68-75 kDa
• GenBank Accession Number: BC000061
• Gene Symbol: ATG16L1
• Gene ID (NCBI): 55054
• RRID: AB_2934788
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q676U5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 63 kDa; and Atg16L1β, 71 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)