ATG16L1 Monoclonal antibody

ATG16L1 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 67943-1-Ig
Clone No.1G5G7

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat and More (2)

Applications

WB, IF/ICC, IP, ELISA

APG16 like 1, APG16L, ATG16L, ATG16L1, Autophagy related protein 16 1, FLJ00045, FLJ10035, FLJ10828, FLJ22677, IBD10, WDR30

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHSC-T6 cells, HepG2 cells, rat lung tissue, PC-12 cells, NIH/3T3 cells, 4T1 cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67943-1-Ig targets ATG16L1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Cited Reactivityhuman, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14881

Product name: Recombinant human ATG16L1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 258-607 aa of BC000061

Sequence: RAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDAHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

Predict reactive species
Full Name ATG16 autophagy related 16-like 1 (S. cerevisiae)
Calculated Molecular Weight 607 aa, 68 kDa
Observed Molecular Weight68-75 kDa
GenBank Accession NumberBC000061
Gene Symbol ATG16L1
Gene ID (NCBI) 55054
RRIDAB_2918695
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ676U5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 63 kDa; and Atg16L1β, 71 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931)

Protocols

Product Specific Protocols
IF protocol for ATG16L1 antibody 67943-1-IgDownload protocol
WB protocol for ATG16L1 antibody 67943-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigWB

Front Immunol

Porcine cGAS-STING signaling induced autophagy inhibits STING downstream IFN and apoptosis

Authors - Nengwen Xia
humanWB

Epileptic Disord

lncRNA UCA1 induces autophagic gene expression via epigenetic regulation mediated by ATG16L1 and miR-132-3p in SH-SY5Y cells treated with retinoic acid

Authors - Fang Wen
humanWB

Mol Carcinog

Forkhead Box Q1 is a novel regulator of autophagy in breast cancer cells

Authors - Su-Hyeong Kim
humanWB,IF

Dev Cell

V-ATPase recruitment to ER exit sites switches COPII-mediated transport to lysosomal degradation

Authors - Yiwei Sun
humanWB

Cell Signal

The hsa_circ_0002371/hsa-miR-502-5p/ATG16L1 axis modulates the survival of intracellular Mycobacterium tuberculosis and autophagy in macrophages

Authors - Jinyi Zhang
humanWB,IP

Theranostics

FUNDC1 alleviates doxorubicin-induced cardiotoxicity by restoring mitochondrial-endoplasmic reticulum contacts and blocked autophagic flux

Authors - Weibin He
Loading...
||
New chat Able
正在加载,请稍候...