ASCC3 Recombinant monoclonal antibody, PBS Only (Detector)

ASCC3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85130-2-PBS
Clone No.242755B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

242755B4, Activating signal cointegrator 1 complex subunit 3, ASC-1 complex subunit p200, ASC1p200, EC:3.6.4.12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85130-2-PBS targets ASCC3 as part of a matched antibody pair:

MP01828-3: 85130-4-PBS capture and 85130-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11848

Product name: Recombinant human ASCC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-111 aa of BC050681

Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

Predict reactive species
Full Name activating signal cointegrator 1 complex subunit 3
Calculated Molecular Weight 111 aa, 13 kDa, 251 kDa
Observed Molecular Weight245 kDa
GenBank Accession NumberBC050681
Gene Symbol ASCC3
Gene ID (NCBI) 10973
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N3C0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation.

Loading...
||
New chat Able
正在加载,请稍候...