ASCC3 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 85130-2-RR (same clone as 85130-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85130-2-RR (ASCC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85130-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP01828-3

  Sandwich ELISA standard curve of MP01828-3, Human ASCC3 Recombinant Matched Antibody Pair - PBS only. 85130-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag11848. 85130-2-PBS was HRP conjugated as the detection antibody. Range: 0.195-12.5 ng/mL.

• 

  Sample test of MP01828-3

  The mean ASCC3 concentration was determined to be 17.15 ng/mL in HeLa cell extract based on a 1.30 mg/mL extract load and 23.98 ng/mL in HepG2 cell extract based on a 1.80 mg/mL extract load.

• 

  IF Staining of HeLa using 85130-2-RR (same clone as 85130-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ASCC3 antibody (85130-2-RR, Clone: 242755B4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85130-2-PBS in a different storage buffer formulation.

ASCC3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85130-2-PBS

Clone No.242755B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

242755B4, Activating signal cointegrator 1 complex subunit 3, ASC-1 complex subunit p200, ASC1p200, EC:3.6.4.12

---

Product Information

85130-2-PBS targets ASCC3 as part of a matched antibody pair:

MP01828-3: 85130-4-PBS capture and 85130-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11848

  Product name: Recombinant human ASCC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-111 aa of BC050681

  Sequence: MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

• Full Name: activating signal cointegrator 1 complex subunit 3
• Calculated Molecular Weight: 111 aa, 13 kDa, 251 kDa
• Observed Molecular Weight: 245 kDa
• GenBank Accession Number: BC050681
• Gene Symbol: ASCC3
• Gene ID (NCBI): 10973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N3C0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ASCC3 (Activating Signal Cointegrator 1 Complex Subunit 3) is a multifunctional protein involved in various cellular processes, including transcriptional regulation, DNA repair, and ribosome quality control. It is a member of the ASCC (Activating Signal Cointegrator 1 Complex) family, which functions as a bridge between co-repressors and co-activators in transcriptional regulation.