Product Information
83830-2-PBS targets ALDH1A1 as part of a matched antibody pair:
MP00795-2: 83830-3-PBS capture and 83830-2-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag8665 Product name: Recombinant human ALDH1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 153-501 aa of BC001505 Sequence: TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member A1 |
| Calculated Molecular Weight | 501 aa, 55 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC001505 |
| Gene Symbol | ALDH1A1 |
| Gene ID (NCBI) | 216 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P00352 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001).













