Tested Applications
| Positive WB detected in | LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH-3T3 cells, MDCK cells, Pig brain cells |
| Positive IHC detected in | human kidney tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human kidney tissue |
| Positive IF/ICC detected in | HeLa cells, HCT 116 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67791-1-Ig targets AIF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples.
| Tested Reactivity | human, mouse, rat, pig, canine |
| Cited Reactivity | human, rat, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12400 Product name: Recombinant human AIF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 259-609 aa of BC111065 Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED Predict reactive species |
| Full Name | apoptosis-inducing factor, mitochondrion-associated, 1 |
| Calculated Molecular Weight | 609 aa, 66 kDa |
| Observed Molecular Weight | 67 kDa, 57 kDa |
| GenBank Accession Number | BC111065 |
| Gene Symbol | AIF |
| Gene ID (NCBI) | 9131 |
| RRID | AB_2918555 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95831 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID:19332058).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AIF antibody 67791-1-Ig | Download protocol |
| IHC protocol for AIF antibody 67791-1-Ig | Download protocol |
| WB protocol for AIF antibody 67791-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AIF Monoclonal antibody (8C12B2), catalog number 67791-1-Ig, has 8 total citations. These appear in journals including Redox Biology, Advanced Science, Journal of Orthopaedic Translation, Ecotoxicology and Environmental Safety, Journal of Hypertension, Inflammation, Frontiers in Pharmacology, and Science Advances. The research fields span hepatocellular carcinoma, cardiotoxicity, tendinopathy, intestinal injury, preeclampsia, hepatic ischemia-reperfusion injury, ischemic stroke, and mitochondrial apoptosis.
| Species | Application | Title |
|---|---|---|
Redox Biol Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma. | ||
Adv Sci (Weinh) Use of Deep-Learning Assisted Assessment of Cardiac Parameters in Zebrafish to Discover Cyanidin Chloride as a Novel Keap1 Inhibitor Against Doxorubicin-Induced Cardiotoxicity | ||
J Orthop Translat Methylene blue restores NAD(+)/NADH homeostasis to attenuate Achilles tendinopathy via activating AIF/Mitochondrial respiratory chain complex I.
| ||
Ecotoxicol Environ Saf Taurine ameliorates deoxynivalenol-induced intestinal injury in piglets: Restoration of mitochondrial function linked to the PGC1α-NRF1/2 axis | ||
J Hypertens The effects of metformin on inflammation and apoptosis in rats with preeclampsia | ||
Inflammation Chlorogenic Acid Alleviates Hepatic Ischemia-Reperfusion Injury by Inhibiting Oxidative Stress, Inflammation, and Mitochondria-Mediated Apoptosis In Vivo and In Vitro |
