Tested Applications
| Positive WB detected in | HepG2 cells, K-562 cells, mouse liver tissue, 3T3-L1 cells, NIH/3T3 cells, rat liver tissue |
| Positive IHC detected in | human liver cancer tissue, human renal cell carcinoma tissue, human liver tissue, human colon cancer tissue, human prostate cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | oleic acid treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 114 publications below |
| IHC | See 30 publications below |
| IF | See 71 publications below |
| IP | See 1 publications below |
Product Information
15294-1-AP targets Perilipin-2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, zebrafish, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7539 Product name: Recombinant human ADRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-437 aa of BC005127 Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH Predict reactive species |
| Full Name | adipose differentiation-related protein |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 45-48 kDa |
| GenBank Accession Number | BC005127 |
| Gene Symbol | Perilipin-2 |
| Gene ID (NCBI) | 123 |
| RRID | AB_2878122 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99541 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases. This antibody is not suitable for immunofluorescence staining of frozen sections.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Perilipin-2 antibody 15294-1-AP | Download protocol |
| IHC protocol for Perilipin-2 antibody 15294-1-AP | Download protocol |
| WB protocol for Perilipin-2 antibody 15294-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature iPS-cell-derived microglia promote brain organoid maturation via cholesterol transfer | ||
Signal Transduct Target Ther The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Nat Commun Spliceosome component Usp39 contributes to hepatic lipid homeostasis through the regulation of autophagy | ||
Brain Behav Immun HIV-TAT dysregulates microglial lipid metabolism through SREBP2/miR-124 axis: Implication of lipid droplet accumulation microglia in NeuroHIV |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Samuel (Verified Customer) (07-31-2025) | I found this primary antibody to work quite well, at least from a Western blot perspective, (I have not tried any other applications using this particular antibody). The experimental results came out quite clean and there has been little to no non-specific banding patterns, which is very nice. Lastly, the standard 1:1000 primary antibody dilution I have used works just fine for my needs, which allows the vial to last a decent amount of time. Overall, I would recommend!
|
FH Christin (Verified Customer) (11-25-2024) | Excellent antibody for ICC and WB of human iPSC-derived microglia and macrophages
|
FH Liliana (Verified Customer) (02-13-2024) | WORKS VERY WELL ON PH9, 1:2000 AND ON PH6, 1:1000
![]() |
FH Christine (Verified Customer) (09-19-2023) | Tried on HEK293T cells treated with 300 uM oleic acid overnight to induce the formation of lipid droplets. This antibody decorates some droplets but was a bit weak. TIP47 antibody (10694-1-AP) performed better (clearer detection of the droplets) at the same concentration (1:100).
|
FH Kamal (Verified Customer) (07-05-2023) | Worked well when diluted with 1X PBS.
|
FH Christin (Verified Customer) (03-09-2023) | Great antibody for WB with low background signal.
|
FH Nick (Verified Customer) (04-20-2022) | Helped localize expression of Plin2
|
FH Boyan (Verified Customer) (05-09-2019) | Very good for WB
|


































