ACOX1 Monoclonal antibody

• 

  WB analysis using 68017-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68017-1-Ig (ACOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of rat liver using 68017-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 68017-1-Ig (ACOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 68017-1-Ig

  WB result of ACOX1 antibody (68017-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACOX1 transfected HepG2 cells.

• 

  WB analysis of pig liver using 68017-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 68017-1-Ig (ACOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of NIH/3T3 using 68017-1-Ig

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.25 ug ACOX1 Monoclonal antibody (68017-1-Ig, Clone:3E12E10) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

ACOX1 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 68017-1-Ig

Clone No.3E12E10

Publications(8)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

3E12E10, ACOX, ACOX 1, AOX, EC:1.3.3.6

---

Tested Applications

• Positive WB detected in: LNCaP cells, pig liver tissue, rat liver tissue, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
• Positive FC (Intra) detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 8 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

68017-1-Ig targets ACOX1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28037

  Product name: Recombinant human AOX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 275-660 aa of BC010425

  Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL

• Full Name: acyl-Coenzyme A oxidase 1, palmitoyl
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010425
• Gene Symbol: ACOX1
• Gene ID (NCBI): 51
• RRID: AB_2918763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15067
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse,human	WB,IHC,IF	Pharmacol Res; ACOX1 deficiency-induced lipid metabolic disorder facilitates chronic interstitial fibrosis development in renal allografts; Authors - Yang-He Zhang ; KD Validated
rat	WB,IF	Phytomedicine; An integrated network pharmacology and cell metabolomics approach to reveal the role of rhein, a novel PPARα agonist, against renal fibrosis by activating the PPARα-CPT1A axis.; Authors - Qiming Xiao
rat	WB	Front Pharmacol; Lipidomics reveals the potential mechanism of honokiol against adenine-induced chronic kidney disease; Authors - Xinhui Liu
mouse	WB	Chin J Nat Med; Activation of LONP1 by 84-B10 alleviates aristolochic acid nephropathy via re-establishing mitochondrial and peroxisomal homeostasis; Authors - Xinyue Xu
mouse	WB	Foods; Hericium erinaceus Protein Alleviates High-Fat Diet-Induced Hepatic Lipid Accumulation and Oxidative Stress In Vivo; Authors - Hongzheng Lu
human	WB	Leukemia; Targeting ABCD1-ACOX1-MET/IGF1R axis suppresses multiple myeloma; Authors - Zhannan Han ; KD Validated