Tested Applications
| Positive WB detected in | LNCaP cells, pig liver tissue, rat liver tissue, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68017-1-Ig targets ACOX1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28037 Product name: Recombinant human AOX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 275-660 aa of BC010425 Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL Predict reactive species |
| Full Name | acyl-Coenzyme A oxidase 1, palmitoyl |
| Calculated Molecular Weight | 74 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC010425 |
| Gene Symbol | ACOX1 |
| Gene ID (NCBI) | 51 |
| RRID | AB_2918763 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15067 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ACOX1 antibody 68017-1-Ig | Download protocol |
| IHC protocol for ACOX1 antibody 68017-1-Ig | Download protocol |
| WB protocol for ACOX1 antibody 68017-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACOX1 Monoclonal antibody (3E12E10), catalog number 68017-1-Ig, has 12 citations. These appear in journals including Nature Communications, Advanced Science, Cell Death & Disease, Pharmacological Research, Leukemia, Phytomedicine, Biochemical Pharmacology, International Journal of Molecular Sciences, Frontiers in Pharmacology, Chinese Journal of Natural Medicines, Journal of Orthopaedic Research, and Foods. Research fields span lipid metabolism, renal fibrosis, liver disease, ovarian cancer, multiple myeloma, nephropathy, hepatocellular carcinoma, and tendon regeneration.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Gut Mycobiota-Associated Tryptophan Catabolites Protect Against Metabolic Dysfunction-Associated Steatotic Liver Disease. | ||
Pharmacol Res ACOX1 deficiency-induced lipid metabolic disorder facilitates chronic interstitial fibrosis development in renal allografts
| ||
Cell Death Dis IGF2BP3/ESM1/KLF10/BECN1 positive feedback loop: a novel therapeutic target in ovarian cancer via lipid metabolism reprogramming | ||
Phytomedicine An integrated network pharmacology and cell metabolomics approach to reveal the role of rhein, a novel PPARα agonist, against renal fibrosis by activating the PPARα-CPT1A axis. | ||
Chin J Nat Med Activation of LONP1 by 84-B10 alleviates aristolochic acid nephropathy via re-establishing mitochondrial and peroxisomal homeostasis |
