ACOX1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68017-1-Ig (same clone as 68017-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68017-1-Ig (ACOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68017-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 68017-1-Ig (same clone as 68017-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 68017-1-Ig (ACOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68017-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68017-1-Ig (same clone as 68017-1-PBS)

  WB result of ACOX1 antibody (68017-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACOX1 transfected HepG2 cells. This data was developed using the same antibody clone with 68017-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 68017-1-Ig (same clone as 68017-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 68017-1-Ig (ACOX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68017-1-PBS in a different storage buffer formulation.

• 

  FC experiment of NIH/3T3 using 68017-1-Ig (same clone as 68017-1-PBS)

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.25 ug ACOX1 Monoclonal antibody (68017-1-Ig, Clone:3E12E10) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68017-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ACOX1 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 68017-1-PBS

Clone No.3E12E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, FC (Intra), ELISA

Synonyms

3E12E10, ACOX, ACOX 1, AOX, EC:1.3.3.6

---

Product Information

68017-1-PBS targets ACOX1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28037

  Product name: Recombinant human AOX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 275-660 aa of BC010425

  Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL

• Full Name: acyl-Coenzyme A oxidase 1, palmitoyl
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010425
• Gene Symbol: ACOX1
• Gene ID (NCBI): 51
• RRID: AB_2918763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15067
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).