Aconitase 2 Monoclonal antibody, PBS Only

Aconitase 2 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 67509-1-PBS
Clone No.1F1G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), Indirect ELISA

ACO2, Citrate hydro-lyase, Aconitase2, Aconitase, ACO 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67509-1-PBS targets Aconitase 2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17784

Product name: Recombinant human ACO2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-306 aa of BC014092

Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY

Predict reactive species
Full Name aconitase 2, mitochondrial
Calculated Molecular Weight 85 kDa
Observed Molecular Weight 85 kDa
GenBank Accession NumberBC014092
Gene Symbol ACO2
Gene ID (NCBI) 50
RRIDAB_2882730
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99798
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).

Loading...
||
New chat Able
正在加载,请稍候...