Aconitase 2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67509-1-Ig (same clone as 67509-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67509-1-Ig (ACO2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67509-1-Ig (same clone as 67509-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67509-1-Ig (ACO2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67509-1-Ig (same clone as 67509-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67509-1-Ig (ACO2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67509-1-Ig (same clone as 67509-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67509-1-Ig (ACO2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67509-1-Ig (same clone as 67509-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67509-1-Ig (ACO2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67509-1-Ig (same clone as 67509-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67509-1-Ig (ACO2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67509-1-Ig (same clone as 67509-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67509-1-Ig (ACO2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67509-1-Ig (same clone as 67509-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67509-1-Ig (ACO2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67509-1-Ig (same clone as 67509-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ACO2 (67509-1-Ig, Clone:1F1G4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67509-1-PBS in a different storage buffer formulation.

Aconitase 2 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 67509-1-PBS

Clone No.1F1G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

ACO2, Citrate hydro-lyase, Aconitase2, Aconitase, ACO 2

---

Product Information

67509-1-PBS targets Aconitase 2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17784

  Product name: Recombinant human ACO2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-306 aa of BC014092

  Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY

• Full Name: aconitase 2, mitochondrial
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC014092
• Gene Symbol: ACO2
• Gene ID (NCBI): 50
• RRID: AB_2882730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q99798
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).