MRP1 Monoclonal antibody

• 

  WB analysis using 67228-1-Ig

  Non-boil and boiled HepG2 and A549 cell lysates were subjected to SDS PAGE followed by western blot with 67228-1-Ig (ABCC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. Left panel was exposed for 20 sec. and right panel was exposed for 1 min.

• 

  IF Staining of A549 using 67228-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using MRP1 antibody (67228-1-Ig, Clone: 1G4A2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

MRP1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67228-1-Ig

Clone No.1G4A2

Publications(19)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ABCC1, 1G4A2, MRP1/ABCC1

---

Tested Applications

• Positive WB detected in: unboiled HepG2 cells, unboiled A549 cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 17 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

67228-1-Ig targets MRP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27048

  Product name: Recombinant human ABCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 918-1025 aa of NM_004996

  Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS

• Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
• Calculated Molecular Weight: 172 kDa
• Observed Molecular Weight: 180-190 kDa
• GenBank Accession Number: NM_004996
• Gene Symbol: MRP1
• Gene ID (NCBI): 4363
• RRID: AB_2882516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P33527
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Multidrug resistant-associated protein 1 (MRP1; ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Environ Pollut; Biotransformation of graphene oxide within lung fluids could intensify its synergistic biotoxicity effect with cadmium by inhibiting cellular efflux of cadmium.; Authors - Jianqiang Zhu
human	WB	Cancers (Basel); NCAPG2 Maintains Cancer Stemness and Promotes Erlotinib Resistance in Lung Adenocarcinoma; Authors - Shiyao Jiang
human	WB	Commun Chem; Exploring bat-inspired cyclic tryptophan diketopiperazines as ABCB1 Inhibitors; Authors - Javier Yu Peng Koh ; KD Validated
human	WB	Front Cell Dev Biol; Apatinib Suppresses Gastric Cancer Stem Cells Properties by Inhibiting the Sonic Hedgehog Pathway.; Authors - Wanshuang Cao
human	WB	Transl Oncol; Pan-cancer analysis of ABCC1 as a potential prognostic and immunological biomarker; Authors - Tiantian Wang
human	WB	Biochem Pharmacol; PMID: 32535103; Authors - Qi Feng