Product Information
60246-1-PBS targets 4EBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.
Tested Reactivity | human, pig |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18985 Product name: Recombinant human 4EBP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species |
Full Name | eukaryotic translation initiation factor 4E binding protein 1 |
Calculated Molecular Weight | 118 aa, 12 kDa |
Observed Molecular Weight | 15-24 kDa |
GenBank Accession Number | BC004459 |
Gene Symbol | EIF4EBP1 |
Gene ID (NCBI) | 1978 |
RRID | AB_2881368 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q13541 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Eukaryotic translation initiation factor 4E-binding protein 1(4EBP1), is a member of 4EBPs family, which regulate the translation of a subset of mRNA by competing with eIF4G for binding to eIF4E, thus preventing the assembly of the eIF4F complex. The eIF4F facilitates the recruitment of other translation initiation factors to form the complex and then initiates cap-dependent translation.4EBP1 also mediates the regulation of protein translation by growth factors, hormones and other stimuli that signal through the MAP kinase and mTORC1 pathways. There are three forms of 4EBP1, alpha, beta and gamma.typical pattern seen on Western blots for phosphorylated heat-acid stabled protein 4EBP1 from rat gastrocnemius muscle. Three distinct bands are noted, with the most rapidly migrating band having an apparent molecular mass of ; 20 kDa and the slowest migrating band of; 24 kDa. The 3 bands are designated by convention asalpha, beta and gamma. (PMID: 10913029)