MCM2 Recombinant monoclonal antibody, PBS Only (Capture)

MCM2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 84511-2-PBS
Clone No.241968D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

241968D3, BM28, CCNL1, CDCL1, EC:3.6.4.12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84511-2-PBS targets MCM2 as part of a matched antibody pair:

MP01392-2: 84511-2-PBS capture and 84511-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0798

Product name: Recombinant human MCM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 657-904 aa of BC007670

Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

Predict reactive species
Full Name minichromosome maintenance complex component 2
Calculated Molecular Weight 102 kDa
Observed Molecular Weight 116-125 kDa
GenBank Accession NumberBC007670
Gene Symbol MCM2
Gene ID (NCBI) 4171
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49736
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The MCM2-7 complex forms the core of the replicative helicase which acts as the molecular motor that uses ATP binding and hydrolysis to fuel the unwinding of double-stranded DNA at the replication fork in eukaryotes. This complex is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. MCM2, also named CDCL1 and BM28, is a human nuclear protein that plays an important role in 2 crucial steps of the cell cycle, namely, onset of DNA replication and cell division.

Loading...
||
New chat Able
正在加载,请稍候...