VDAC2 Recombinant monoclonal antibody

VDAC2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 84225-2-RR
Clone No.241569G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

241569G11, FLJ23841, hVDAC2, VDAC 2, VDAC-2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HuH-7 cells, L02 cells, mouse brain tissue, mouse heart tissue, rat brain tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84225-2-RR targets VDAC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2266

Product name: Recombinant human VDAC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-294 aa of BC000165

Sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA

Predict reactive species
Full Name voltage-dependent anion channel 2
Calculated Molecular Weight 294 aa, 32 kDa
Observed Molecular Weight 31-33 kDa
GenBank Accession NumberBC000165
Gene Symbol VDAC2
Gene ID (NCBI) 7417
RRIDAB_3671778
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP45880
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VDACs (Voltage Dependent Anion selective Channels), also known as mitochondrial porins, are a family of pore-forming proteins discovered in the mitochondrial outer membrane. Mammals show a conserved genetic organization of the VDAC genes. It's reported that the amount of VDAC transcripts in liver is usually lower than in the other tissues. VDAC2 and especially VDAC3 are highly expressed in testis, while mouse VDAC1 is poorly expressed in this tissue. (PMID: 22020053)

Protocols

Product Specific Protocols
WB protocol for VDAC2 antibody 84225-2-RRDownload protocol
IHC protocol for VDAC2 antibody 84225-2-RRDownload protocol
IF protocol for VDAC2 antibody 84225-2-RRDownload protocol
IP protocol for VDAC2 antibody 84225-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...