• Featured Product
  • KD/KO Validated

Bcl2 Monoclonal antibody

Bcl2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68103-1-Ig
Clone No.1B3F7

Host / Isotype

Mouse / IgG1

Reactivity

mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Bcl-2, 1B3F7, B cell leukemia/lymphoma 2, Bcl 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHSC-T6 cells, C2C12 cells, NIH/3T3 cells, mouse spleen tissue, mouse brain tissue, rat spleen tissue, RAW 264.7 cells, rat brain tissue
Positive IHC detected inmouse kidney tissue, rat skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68103-1-Ig targets Bcl2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Cited Reactivitymouse, rat, pig, chicken, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24261

Product name: Recombinant mouse Bcl2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-236 aa of NM-009741

Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell leukemia/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberNM-009741
Gene Symbol Bcl2
Gene ID (NCBI) 12043
RRIDAB_2923635
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10417
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bcl2 is a member of the B cell lymphoma 2 protein family. Members of this family regulate cell death in multiple cell types and can have either proapoptotic or antiapoptotic activities. The protein encoded by this gene inhibits mitochondrial-mediated apoptosis. This protein is an integral outer mitochondrial membrane protein that functions as part of signaling pathway that controls mitochondrial permeability in response to apoptotic stimuli. This protein may also play a role in neuron cell survival and autophagy. Abnormal expression and chromosomal translocations of this gene are associated with cancer progression in numerous tissues.

Protocols

Product Specific Protocols
WB protocol for Bcl2 antibody 68103-1-IgDownload protocol
IHC protocol for Bcl2 antibody 68103-1-IgDownload protocol
IF protocol for Bcl2 antibody 68103-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Mol Cancer

hsa_circ_0007919 induces LIG1 transcription by binding to FOXA1/TET1 to enhance the DNA damage response and promote gemcitabine resistance in pancreatic ductal adenocarcinoma

Authors - Lei Xu
mouseWB

Bioact Mater

Chemo-immunotherapy by dual-enzyme responsive peptide self-assembling abolish melanoma

Authors - Yuhan Wang
mouseWB

Nucleic Acids Res

MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation

Authors - Bangming Jin
mouseWB

Biomaterials

Myocardial delivery of miR30d with peptide-functionalized milk-derived extracellular vesicles for targeted treatment of hypertrophic heart failure

Authors - Lingjun Tong
WB

Cancer Res

PRKDC Induces Chemoresistance in Osteosarcoma by Recruiting GDE2 to Stabilize GNAS and Activate AKT

Authors - Wenchao Zhang
mouseWB

J Nanobiotechnology

Nanocomposites based on nanoceria regulate the immune microenvironment for the treatment of polycystic ovary syndrome

Authors - Sisi Yan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Amandine (Verified Customer) (02-07-2024)

20ug of protein denatured or not, primary antibody 1/5000 RT and secondary antibody 1/5000 2h RT. Chemiluminescence revelation with 10min of exposition

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/5000
  • Cell Tissue Type: ImCC
Bcl2 Antibody Western Blot validation (1/5000 dilution) in ImCC (Cat no:68103-1-Ig)
Loading...