NQO1 Monoclonal antibody

NQO1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 67240-1-Ig
Clone No.1E5G7

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

1E5G7, Azoreductase, DHQU, DIA 4, DIA4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HSC-T6 cells, L02 cells, K-562 cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67240-1-Ig targets NQO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28933

Product name: Recombinant human NQO1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-144 aa of BC007659

Sequence: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAV

Predict reactive species
Full Name NAD(P)H dehydrogenase, quinone 1
Calculated Molecular Weight 274 aa, 31 kDa
Observed Molecular Weight 29-31 kDa
GenBank Accession NumberBC007659
Gene Symbol NQO1
Gene ID (NCBI) 1728
RRIDAB_2882519
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15559
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NQO1, also named as DIA4, NMOR1, DTD and QR1, belongs to the NAD(P)H dehydrogenase (quinone) family. This enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. It is known to be involved in benzene metabolism. In human studies of ozone exposure, polymorphisms in oxidative stress genes (NQO1, GSTM1, GSTP1) modify respiratory symptoms, lung function, biomarkers and risk of asthma. (PMID:18511640; 18848868 )

Protocols

Product Specific Protocols
FC protocol for NQO1 antibody 67240-1-IgDownload protocol
IF protocol for NQO1 antibody 67240-1-IgDownload protocol
IHC protocol for NQO1 antibody 67240-1-IgDownload protocol
WB protocol for NQO1 antibody 67240-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Redox Biol

Remote ischemic conditioning attenuates oxidative stress and inflammation via the Nrf2/HO-1 pathway in MCAO mice

Authors - Ying-Ying Sun
humanWB

Free Radic Biol Med

Honokiol protects against heavy-ion radiation-induced oxidative damage via the thioredoxin system

Authors - Yaxiong Chen
humanWB

Oxid Med Cell Longev

Farrerol Enhances Nrf2-Mediated Defense Mechanisms against Hydrogen Peroxide-Induced Oxidative Damage in Human Retinal Pigment Epithelial Cells by Activating Akt and MAPK.

Authors - Ning Ma
ratWB

Oxid Med Cell Longev

Xuesaitong Combined with Dexmedetomidine Improves Cerebral Ischemia-Reperfusion Injury in Rats by Activating Keap1/Nrf2 Signaling and Mitophagy in Hippocampal Tissue

Authors - Guo-Jie Han
mouseIHC

Oxid Med Cell Longev

Limonin Inhibits IL-1 β -Induced Inflammation and Catabolism in Chondrocytes and Ameliorates Osteoarthritis by Activating Nrf2

Authors - Jie Jin
humanWB

Acta Pharmacol Sin

Methylene blue prevents osteoarthritis progression and relieves pain in rats via upregulation of Nrf2/PRDX1.

Authors - Jia-Wei Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kamal (Verified Customer) (10-15-2025)

Antibody was diluted 1:10000 in 1xTBST. Bands were clear and appeared around 31 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: Mouse Liver tissue
NQO1 Antibody Western Blot validation (1:10000 dilution) in Mouse Liver tissue (Cat no:67240-1-Ig)
FH

YINGJIAN (Verified Customer) (06-24-2025)

Clean bands, no non-specific binding observed

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: H9C2 cells
NQO1 Antibody Western Blot validation (1:5000 dilution) in H9C2 cells (Cat no:67240-1-Ig)
FH

Hala (Verified Customer) (07-28-2021)

incubation 1.5 hours at room temperature dilution 1/7000 could use more diluted concentration

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/7000
  • Cell Tissue Type: HepG2
NQO1 Antibody Western Blot validation (1/7000 dilution) in HepG2 (Cat no:67240-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...