• Featured Product
  • KD/KO Validated

CRABP2 Monoclonal antibody

CRABP2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 66468-1-Ig
Clone No.1A5F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

1A5F3, Cellular retinoic acid binding protein II, Cellular retinoic acid-binding protein 2, Cellular retinoic acid-binding protein II, CRABP II

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inT-47D cells, HEK-293 cells, MCF-7 cells, pig skin tissue, rat skin tissue
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman skin cancer tissue
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2500-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66468-1-Ig targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0309

Product name: Recombinant human CRABP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-138 aa of BC001109

Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Predict reactive species
Full Name cellular retinoic acid binding protein 2
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC001109
Gene Symbol CRABP2
Gene ID (NCBI) 1382
RRIDAB_2881836
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP29373
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.

Protocols

Product Specific Protocols
FC protocol for CRABP2 antibody 66468-1-IgDownload protocol
IF protocol for CRABP2 antibody 66468-1-IgDownload protocol
IHC protocol for CRABP2 antibody 66468-1-IgDownload protocol
WB protocol for CRABP2 antibody 66468-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanIHC,IF

Cell Death Dis

Upregulation of CRABP2 by TET1-mediated DNA hydroxymethylation attenuates mitochondrial apoptosis and promotes oxaliplatin resistance in gastric cancer

Authors - Xiaolong Tang
humanWB,IHC,IF

Cell Signal

CRABP2 promotes peritoneal metastasis in CRC through TGF-β/Smad-mediated EMT signaling and invadopodia formation

Authors - Wende Hao
humanWB

PLoS One

Increased sensitivity of primary aniridia limbal stromal cells to travoprost, leading to elevated migration and MMP-9 protein levels, in vitro

Authors - Shuailin Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Linyi (Verified Customer) (01-17-2019)

We use this antibody on porcine chondrocytes lysate, 1/1000 dilution.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: chondrocytes, pig
CRABP2 Antibody Western Blot, validation (1/1000 dilution) in chondrocytes, pig (Cat no:66468-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...