• Featured Product
  • KD/KO Validated

ZO-1 Monoclonal antibody

ZO-1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66452-1-Ig
Clone No.1G4A1

Host / Isotype

Mouse / IgG1

Reactivity

human, canine and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

TJP1, ZO 1, Tight junction protein ZO-1, Tight junction protein ZO 1, Tight junction protein 1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, HeLa cells, COLO 320 cells, A431 cells, LNCaP cells, HEK-293 cells, HepG2 cells
Positive IHC detected inhuman pancreas cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive IF/ICC detected inMCF-7 cells, MDCK cells

Freshly prepared samples are recommended.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66452-1-Ig targets ZO-1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Cited Reactivityhuman, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16454

Product name: Recombinant human ZO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1446-1748 aa of BC111712

Sequence: SLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Predict reactive species
Full Name tight junction protein 1 (zona occludens 1)
Calculated Molecular Weight 1748 aa, 195 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC111712
Gene Symbol ZO-1
Gene ID (NCBI) 7082
RRIDAB_2881821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ07157
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tight junction (or zonula occludens) form the continuous intercellular barrier between epithelial and endothelial cells, which is required to separate tissue spaces and regulate selective movement of solutes across the epithelium and endothelium (PMID: 20066090). ZO-1 (also known as TJP1) is a peripheral membrane phosphoprotein located on the cytoplasmic face and is expressed in tight junctions of both epithelial and endothelial cells (PMID: 3528172). It binds the transmembrane proteins occludin and the claudins linking them to cytoskeletal actin (PMID: 17418867). ZO-1 belongs to a family of multidomain proteins known as the membrane-associated guanylate kinase homologs (MAGUKs). It is a pivotal tight junction protein and may be involved in signalling mechanisms regulating cell proliferation and differentiation (PMID: 22782886).

Protocols

Product Specific Protocols
WB protocol for ZO-1 antibody 66452-1-IgDownload protocol
IHC protocol for ZO-1 antibody 66452-1-IgDownload protocol
IF protocol for ZO-1 antibody 66452-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

ACS Nano

Mind the Particle Rigidity: Blooms the Bioavailability via Rapidly Crossing the Mucus Layer and Alters the Intracellular Fate of Curcumin

Authors - Dan Yuan
WB

Sci Adv

Astrocytic NDRG2-PPM1A interaction exacerbates blood-brain barrier disruption after subarachnoid hemorrhage

Authors - Dayun Feng
humanWB,IF

Nat Commun

An electrochemical biosensor for the detection of epithelial-mesenchymal transition.

Authors - Xin Du
humanIF

Cell Death Differ

SARS-CoV-2 spike protein dictates syncytium-mediated lymphocyte elimination.

Authors - Zhengrong Zhang
humanIF

ACS Appl Mater Interfaces

Betaine-Based and Polyguanidine-Inserted Zwitterionic Micelle as a Promising Platform to Conquer the Intestinal Mucosal Barrier

Authors - Kedong Liu
humanIF

Int J Biol Macromol

zwitterionic Pluronic analog-coated PLGA nanoparticles for oral insulin delivery

Authors - Kedong Liu
Loading...