• Featured Product
  • KD/KO Validated

IL-10 Monoclonal antibody

IL-10 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 60269-1-Ig
Clone No.8E4B6

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, ELISA, Cell treatment

IL-10,IL10, 8E4B6, CSIF, IL 10, IL10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inag14870
Positive IF/ICC detected inMOLT-4 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60269-1-Ig targets IL-10 in WB, IHC, IF/ICC, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat, rabbit, zebrafish
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14870

Product name: Recombinant human IL-10 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 19-178 aa of BC104252

Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Predict reactive species
Full Name interleukin 10
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC104252
Gene Symbol IL-10
Gene ID (NCBI) 3586
RRIDAB_2881389
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22301
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin (IL)-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.

Protocols

Product Specific Protocols
IF protocol for IL-10 antibody 60269-1-IgDownload protocol
IHC protocol for IL-10 antibody 60269-1-IgDownload protocol
WB protocol for IL-10 antibody 60269-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IHC

Bioact Mater

A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds

Authors - Shunlai Shang
WB

Adv Healthc Mater

One-Step Synthesis of Multifunctional Chitosan Hydrogel for Full-Thickness Wound Closure and Healing.

Authors - Shen Guo
rabbitIF

J Control Release

3D mesenchymal stem cell exosome-functionalized hydrogels for corneal wound healing

Authors - Yuehe Xu
WB

Mater Today Bio

Injectable multifunctional CMC/HA-DA hydrogel for repairing skin injury.

Authors - Longlong Cui
humanIHC

J Immunother Cancer

Helicobacter pylori infection disturbs the tumor immune microenvironment and is associated with a discrepant prognosis in gastric de novo diffuse large B-cell lymphoma.

Authors - Yuwei Deng
WB

Mol Ther

Host liver-derived extracellular vesicles deliver miR-142a-3p induces neutrophil extracellular traps via targeting WASL to block the development of Schistosoma japonicum.

Authors - Lifu Wang
Loading...
||
New chat

Able

正在加载,请稍候...