Tested Applications
| Positive WB detected in | fetal human brain tissue, C6 cells, human brain tissue, pig brain tissue |
| Positive IHC detected in | human lung cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon tissue, human tonsillitis tissue |
| Positive IF/ICC detected in | SH-SY5Y cells, human colon tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 4 publications below |
| IF | See 5 publications below |
Product Information
60238-1-Ig targets NCAM1/CD56 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5732 Product name: Recombinant human NCAM1/CD56 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-352 aa of BC047244 Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE Predict reactive species |
| Full Name | neural cell adhesion molecule 1 |
| Calculated Molecular Weight | 95 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC047244 |
| Gene Symbol | NCAM1 |
| Gene ID (NCBI) | 4684 |
| ENSEMBL Gene ID | ENSG00000149294 |
| RRID | AB_2881361 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P13591 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isofroms have also been described (PMID: 1856291).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NCAM1/CD56 antibody 60238-1-Ig | Download protocol |
| IHC protocol for NCAM1/CD56 antibody 60238-1-Ig | Download protocol |
| WB protocol for NCAM1/CD56 antibody 60238-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Small Nanobody-Engineered Natural Killer Cell Conjugates for Solid Tumor Adoptive Immunotherapy | ||
J Transl Med Systematic analysis of various RNA transcripts and construction of biological regulatory networks at the post-transcriptional level for chronic obstructive pulmonary disease | ||
Rheumatology (Oxford) Interleukin-6 trans-signaling regulates monocyte chemoattractant protein-1 production in immune-mediated necrotizing myopathy | ||
Stem Cells Dev Effect of the Soluble Factors Released by Dental Apical Papilla-Derived Stem Cells on the Osteo/Odontogenic, Angiogenic, and Neurogenic Differentiation of Dental Pulp Cells. | ||
Jpn J Clin Oncol Identification of distinct genomic features reveals frequent somatic AHNAK and PTEN mutations predominantly in primary malignant melanoma presenting in the ureter. | ||
J Adv Res Ion interference induced by Ca-Mn nanoplatform enhances ferroptosis and promotes immune response for osteosarcoma treatment |























