Integrin beta-6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin beta-6 Polyclonal antibody (28378-1-AP)

Integrin beta-6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28378-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

Integrin beta 6, Integrin beta-6, integrin, beta 6, ITGB6

• 

  WB analysis using 28378-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 28378-1-AP (Integrin beta-6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 28378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28378-1-AP (Integrin beta-6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 28378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28378-1-AP (Integrin beta-6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Integrin beta-6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28378-1-AP targets Integrin beta-6 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29002

  Product name: Recombinant human Integrin beta-6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 596-709 aa of BC121178

  Sequence: DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP

• Full Name: integrin, beta 6
• Calculated Molecular Weight: 788 aa, 86 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC121178
• Gene Symbol: Integrin beta 6
• Gene ID (NCBI): 3694
• RRID: AB_2918157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB6 belongs to the integrin beta chain family. ITGB6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion.

Publications

What published studies show

The Integrin beta-6 Polyclonal antibody (Cat# 28378-1-AP) has 7 citations published in Sci Adv, Chin Med J (Engl), Respir Res, Transl Lung Cancer Res, Front Oncol, PLoS One, and Cancer Cell Int. Research fields span pulmonary inflammation/ARDS, pancreatic cancer metastasis and prognosis, tuberculous pleural fibrosis, lung adenocarcinoma, gastric carcinoma, and odontogenesis, with applications in WB, IHC, and IF.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Sci Adv; Biomimetic targeted self-adaptive nanodrug for inflammation optimization and AT2 cell modulation in precise ARDS therapy; Authors - Cheng Chen
human, mouse	WB,IHC	Chin Med J (Engl); Effect of TGFβ-ITGB6 feedback loop on liver metastasis in SMAD4 wild-type pancreatic cancer.; Authors - Yutong Zhao ; KD Validated
human	WB,IF	Respir Res; Exosomal microRNAs of tuberculous pleural effusion orchestrating TGF-β signaling mediate pleural fibrosis.; Authors - Li-Juan Jiang
human	IHC	Front Oncol; The association and clinicopathological significance of Integrin alphavbeta6 and Rac1 expression in gastric carcinoma; Authors - Junjian Yu
human	WB,IHC	Transl Lung Cancer Res; Exosomal ITGB6 from dormant lung adenocarcinoma cells activates cancer-associated fibroblasts by KLF10 positive feedback loop and the TGF-β pathway; Authors - Xiang Feng
human,mouse	WB	PLoS One; Odontogenesis-associated phosphoprotein (ODAPH) Promotes Ameloblast adhesion and alkaline phosphatase (ALP) expression via LAMC2/ ITGB6/TGF-β1 signaling pathway; Authors - Mingyue Li