Results

GFP-Traps (12 total products)

5525 Publications

Reviews (31)

Conjugation

Agarose, Magnetic agarose, Magnetic Particles M-270
-_- / -_-

Cat No. gtak-iST, gtd, gta, gtak, gtdk, gtma, gtmak, tbta, tbtak, tbtak-iST, tbtma, tbtmak
GFP-Traps (12 total products)
-_- / -_-
RFP-Traps (7 total products)

397 Publications

Reviews (4)

Conjugation

Agarose, Magnetic agarose, Magnetic Particles M-270
-_- / -_-

Cat No. rta, rtak, rtak-iST, rtd, rtdk, rtma, rtmak
RFP-Traps (7 total products)
-_- / -_-
Myc-Traps (5 total products)

258 Publications

Reviews (4)

Conjugation

Agarose, Magnetic agarose
-_- / -_-

Cat No. yta, ytak, ytak-iST, ytma, ytmak
Myc-Traps (5 total products)
-_- / -_-
V5-Traps (7 total products)

35 Publications

Reviews (6)

Conjugation

Agarose, Magnetic agarose , Magnetic Particles M-270
-_- / -_-

Cat No. v5tak-iST, v5td, v5tdk, v5tma, v5tmak, v5ta, v5tak
V5-Traps (7 total products)
-_- / -_-
mNeonGreen-Traps (5 total products)

33 Publications

Conjugation

Agarose, Magnetic agarose
-_- / -_-

Cat No. nta, ntak, ntak-iST, ntma, ntmak
mNeonGreen-Traps (5 total products)
-_- / -_-
DYKDDDDK-Fab-Traps (3 total products)

31 Publications

Reviews (6)

Conjugation

Agarose
-_- / -_-

Cat No. ffa, ffak, ffap
DYKDDDDK-Fab-Traps (3 total products)
-_- / -_-
MBP-Traps (2 total products)

19 Publications

Conjugation

Agarose
-_- / -_-

Cat No. mbta, mbtak
MBP-Traps (2 total products)
-_- / -_-
GST-Traps (2 total products)

17 Publications

Conjugation

Agarose
-_- / -_-

Cat No. stak, sta
GST-Traps (2 total products)
-_- / -_-
Halo-Traps (6 total products)

16 Publications

Reviews (4)

Conjugation

Agarose, Magnetic agarose, Magnetic Particles M-270
-_- / -_-

Cat No. ota, otak, otd, otdk, otma, otmak
Halo-Traps (6 total products)
-_- / -_-
Spot-Traps (7 total products)

16 Publications

Reviews (1)

Conjugation

Agarose, Magnetic agarose, Magnetic Particles M-270
-_- / -_-

Cat No. eta, etak, etak-iST, etd, etdk, etma, etmak
Spot-Traps (7 total products)
-_- / -_-
p53-N-term-Traps (2 total products)

9 Publications

Conjugation

Agarose
-_- / -_-

Cat No. pta, ptak
p53-N-term-Traps (2 total products)
-_- / -_-
PARP1-Traps (2 total products)

6 Publications

Conjugation

Agarose
-_- / -_-

Cat No. xta, xtak
PARP1-Traps (2 total products)
-_- / -_-
p53-C-term-Traps (2 total products)

5 Publications

Conjugation

Agarose
-_- / -_-

Cat No. pta2, pta2k
p53-C-term-Traps (2 total products)
-_- / -_-
SNAP-CLIP-tag-Traps (2 total products)

3 Publications

Conjugation

Agarose
-_- / -_-

Cat No. wta, wtak
SNAP-CLIP-tag-Traps (2 total products)
-_- / -_-
MK2-Traps (2 total products)

2 Publications

Conjugation

Agarose
-_- / -_-

Cat No. mta, mtak
MK2-Traps (2 total products)
-_- / -_-
Ubiquitin-Traps (4 total products)

2 Publications

Reviews (1)

$The ubiquitin-trap agarose (uta) was used to immunoprecipitate endogenous ubiquitin and ubiquitinylated proteins from human (HEK293T), mouse (C2C12), and hamster (CHO) cell lines treated with MG-132. For each IP, samples of the input lysate (I), non-bound flow-through (F), and bound (B) fractions were analyzed using western blot. Ubiquitin recombinant antibody (80992-1-RR) and HRP-conjugated Affinipure Goat Anti-Rabbit IgG (H+L) (SA00001-2) were used in the western blot analysis.$

Conjugation

Agarose, Magnetic Agarose
-_- / -_-

Cat No. uta, utak, utma, utmak
$The ubiquitin-trap agarose (uta) was used to immunoprecipitate endogenous ubiquitin and ubiquitinylated proteins from human (HEK293T), mouse (C2C12), and hamster (CHO) cell lines treated with MG-132. For each IP, samples of the input lysate (I), non-bound flow-through (F), and bound (B) fractions were analyzed using western blot. Ubiquitin recombinant antibody (80992-1-RR) and HRP-conjugated Affinipure Goat Anti-Rabbit IgG (H+L) (SA00001-2) were used in the western blot analysis.$

Ubiquitin-Traps (4 total products)
-_- / -_-
DNMT1-Traps (2 total products)

1 Publications

Conjugation

Agarose
-_- / -_-

Cat No. dta, dtak
DNMT1-Traps (2 total products)
-_- / -_-
HA-Traps (6 total products)

1 Publications

Reviews (4)

$The HA-Trap Agarose (left) and a competitor resin (right) were used to immunoprecipitate TOM70-HA fusion protein from either untransfected (mock) HEK293T cells or HEK293T cell transfected with full-length TOM70-HA construct. Immunoprecipitation with HA-Trap Agarose results in clean, single-band pulldowns without any heavy and light chain contamination. SDS-PAGE analysis was done on samples from the Input (I), Flow-through (F), Bound (B) fractions.$

Conjugation

Agarose, Magnetic Agarose, Magnetic Particles M-270
-_- / -_-

Cat No. ata, atak, atd, atdk, atma, atmak
$The HA-Trap Agarose (left) and a competitor resin (right) were used to immunoprecipitate TOM70-HA fusion protein from either untransfected (mock) HEK293T cells or HEK293T cell transfected with full-length TOM70-HA construct. Immunoprecipitation with HA-Trap Agarose results in clean, single-band pulldowns without any heavy and light chain contamination. SDS-PAGE analysis was done on samples from the Input (I), Flow-through (F), Bound (B) fractions.$

HA-Traps (6 total products)
-_- / -_-
Mdm4-HdmX-Traps (2 total products)

Conjugation

Agarose
-_- / -_-

Cat No. hta, htak
Mdm4-HdmX-Traps (2 total products)
-_- / -_-
Strep-NanoTrap Agarose

View More Images (3)

×
IP of StrepTag-Aurora Kinase B fusion protein from transfected HEK293T cells using either Strep-NanoTrap Agarose (left) or a Competitor Resin (right). The Strep-NanoTrap binds with higher affinity to the strep-tagged protein in comparison to the competitor product. I: Input, F: Flow-Through, B: Bound.

Application

IP, Co-IP

Conjugate

Agarose

Specificity

Strep-Tag® (sequence: SAWSHPQFEK)

Sizes
-_- / -_-

Cat No. qta
Strep-NanoTrap Agarose
-_- / -_-
×

The search results gallery shows a selection of our total image library
More validation images available on the product page

IP of StrepTag-Aurora Kinase B fusion protein from transfected HEK293T cells using either Strep-NanoTrap Agarose (left) or a Competitor Resin (right). The Strep-NanoTrap binds with higher affinity to the strep-tagged protein in comparison to the competitor product. I: Input, F: Flow-Through, B: Bound.

$Co-IP using Strep-NanoTrap Agarose followed by multiplexed WB of StrepTag-AurKinB, CDC37, and HSP090AB1 proteins from untransfected (mock) HEK293T cells and HEK293T cells transfected with StrepTag-Aurora Kinase B construct. WB analysis was done on samples from the Input (I), Flow-through (F) and Bound (B) fractions of the IP. For the WB analysis, StrepTag was detected using an Anti-StrepTag DY-649 antibody, CDC37 was detected with an Anti-CDC37 Monoclonal Antibody (66420-1-Ig) labeled with FlexAble CoraLite Plus 750 Antibody Labeling Kit for Mouse IgG2a (KFA044), and HSP90AB1 was detected using an Anti-HSP90AB1 Monoclonal Antibody (67450-1-Ig) labeled with FlexAble CoraLite Plus 488 Antibody Labeling Kit for Mouse IgG2b (KFA061).$

Co-IP using Strep-NanoTrap Agarose followed by multiplexed WB of StrepTag-AurKinB, CDC37, and HSP090AB1 proteins from untransfected (mock) HEK293T cells and HEK293T cells transfected with StrepTag-Aurora Kinase B construct. WB analysis was done on samples from the Input (I), Flow-through (F) and Bound (B) fractions of the IP. For the WB analysis, StrepTag was detected using an Anti-StrepTag DY-649 antibody, CDC37 was detected with an Anti-CDC37 Monoclonal Antibody (66420-1-Ig) labeled with FlexAble CoraLite Plus 750 Antibody Labeling Kit for Mouse IgG2a (KFA044), and HSP90AB1 was detected using an Anti-HSP90AB1 Monoclonal Antibody (67450-1-Ig) labeled with FlexAble CoraLite Plus 488 Antibody Labeling Kit for Mouse IgG2b (KFA061).

$IP followed by WB of either N- (left) or C- (right) terminally-linked TwinStrepTag-Aurora Kinase B fusion proteins from transfected HEK293T cells using either Strep-NanoTrap Agarose or a Competitor Resin. The Strep-NanoTrap binds to both N- and C-terminally linked TwinStrepTag proteins with higher affinity than the competitor product. WB analysis additionally indicates that all TwinStrepTagged material is sucessfully eluted in the Bound (B) fraction, with little to no material left in the Flow-Through (F).$

IP followed by WB of either N- (left) or C- (right) terminally-linked TwinStrepTag-Aurora Kinase B fusion proteins from transfected HEK293T cells using either Strep-NanoTrap Agarose or a Competitor Resin. The Strep-NanoTrap binds to both N- and C-terminally linked TwinStrepTag proteins with higher affinity than the competitor product. WB analysis additionally indicates that all TwinStrepTagged material is sucessfully eluted in the Bound (B) fraction, with little to no material left in the Flow-Through (F).
Strep-NanoTrap Agarose Kit

View More Images (3)

×
IP of StrepTag-Aurora Kinase B fusion protein from transfected HEK293T cells using either Strep-NanoTrap Agarose (left) or a Competitor Resin (right). The Strep-NanoTrap binds with higher affinity to the strep-tagged protein in comparison to the competitor product. I: Input, F: Flow-Through, B: Bound.

Application

IP, Co-IP

Conjugate

Agarose

Specificity

Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)

Sizes
-_- / -_-

Cat No. qtak
Strep-NanoTrap Agarose Kit
-_- / -_-
×

The search results gallery shows a selection of our total image library
More validation images available on the product page

IP of StrepTag-Aurora Kinase B fusion protein from transfected HEK293T cells using either Strep-NanoTrap Agarose (left) or a Competitor Resin (right). The Strep-NanoTrap binds with higher affinity to the strep-tagged protein in comparison to the competitor product. I: Input, F: Flow-Through, B: Bound.

$Co-IP using Strep-NanoTrap Agarose followed by multiplexed WB of StrepTag-AurKinB, CDC37, and HSP090AB1 proteins from untransfected (mock) HEK293T cells and HEK293T cells transfected with StrepTag-Aurora Kinase B construct. WB analysis was done on samples from the Input (I), Flow-through (F) and Bound (B) fractions of the IP. For the WB analysis, StrepTag was detected using an Anti-StrepTag DY-649 antibody, CDC37 was detected with an Anti-CDC37 Monoclonal Antibody (66420-1-Ig) labeled with FlexAble CoraLite Plus 750 Antibody Labeling Kit for Mouse IgG2a (KFA044), and HSP90AB1 was detected using an Anti-HSP90AB1 Monoclonal Antibody (67450-1-Ig) labeled with FlexAble CoraLite Plus 488 Antibody Labeling Kit for Mouse IgG2b (KFA061).$

Co-IP using Strep-NanoTrap Agarose followed by multiplexed WB of StrepTag-AurKinB, CDC37, and HSP090AB1 proteins from untransfected (mock) HEK293T cells and HEK293T cells transfected with StrepTag-Aurora Kinase B construct. WB analysis was done on samples from the Input (I), Flow-through (F) and Bound (B) fractions of the IP. For the WB analysis, StrepTag was detected using an Anti-StrepTag DY-649 antibody, CDC37 was detected with an Anti-CDC37 Monoclonal Antibody (66420-1-Ig) labeled with FlexAble CoraLite Plus 750 Antibody Labeling Kit for Mouse IgG2a (KFA044), and HSP90AB1 was detected using an Anti-HSP90AB1 Monoclonal Antibody (67450-1-Ig) labeled with FlexAble CoraLite Plus 488 Antibody Labeling Kit for Mouse IgG2b (KFA061).

$IP followed by WB of either N- (left) or C- (right) terminally-linked TwinStrepTag-Aurora Kinase B fusion proteins from transfected HEK293T cells using either Strep-NanoTrap Agarose or a Competitor Resin. The Strep-NanoTrap binds to both N- and C-terminally linked TwinStrepTag proteins with higher affinity than the competitor product. WB analysis additionally indicates that all TwinStrepTagged material is sucessfully eluted in the Bound (B) fraction, with little to no material left in the Flow-Through (F).$

IP followed by WB of either N- (left) or C- (right) terminally-linked TwinStrepTag-Aurora Kinase B fusion proteins from transfected HEK293T cells using either Strep-NanoTrap Agarose or a Competitor Resin. The Strep-NanoTrap binds to both N- and C-terminally linked TwinStrepTag proteins with higher affinity than the competitor product. WB analysis additionally indicates that all TwinStrepTagged material is sucessfully eluted in the Bound (B) fraction, with little to no material left in the Flow-Through (F).

GFP-Traps (12 total products)

-_- / -_-

-_- / -_-

RFP-Traps (7 total products)

-_- / -_-

-_- / -_-

Myc-Traps (5 total products)

-_- / -_-

-_- / -_-

V5-Traps (7 total products)

-_- / -_-

-_- / -_-

mNeonGreen-Traps (5 total products)

-_- / -_-

-_- / -_-

DYKDDDDK-Fab-Traps (3 total products)

-_- / -_-

-_- / -_-

MBP-Traps (2 total products)

-_- / -_-

-_- / -_-

GST-Traps (2 total products)

-_- / -_-

-_- / -_-

Halo-Traps (6 total products)

-_- / -_-

-_- / -_-

Spot-Traps (7 total products)

-_- / -_-

-_- / -_-

p53-N-term-Traps (2 total products)

-_- / -_-

-_- / -_-

PARP1-Traps (2 total products)

-_- / -_-

-_- / -_-

p53-C-term-Traps (2 total products)

-_- / -_-

-_- / -_-

SNAP-CLIP-tag-Traps (2 total products)

-_- / -_-

-_- / -_-

MK2-Traps (2 total products)

-_- / -_-

-_- / -_-

Ubiquitin-Traps (4 total products)

-_- / -_-

-_- / -_-

DNMT1-Traps (2 total products)

-_- / -_-

-_- / -_-

HA-Traps (6 total products)

-_- / -_-

-_- / -_-

Mdm4-HdmX-Traps (2 total products)

-_- / -_-

-_- / -_-

Strep-NanoTrap Agarose

-_- / -_-

-_- / -_-

Strep-NanoTrap Agarose Kit

-_- / -_-

-_- / -_-

Products derived from