VWF Polyclonal antibody

VWF Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 27186-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

VWF, VWFpp, F8VWF, von Willebrand antigen II, VWD

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, human plasma
Positive IHC detected inhuman tonsillitis tissue, mouse brain tissue, rat brain tissue, human prostate cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27186-1-AP targets VWF in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25578

Product name: Recombinant human vwf protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 754-854 aa of

Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD

Predict reactive species
Full Name von Willebrand factor
Observed Molecular Weight220-250 kDa
Gene Symbol VWF
Gene ID (NCBI) 7450
RRIDAB_2880791
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Von Willebrand factor (VWF) is a large multimeric glycoprotein found in blood plasma involved in hemostasis following vascular injury. 

What is the molecular weight of VWF?

Due to the multimeric nature of VWF, it can range in size from 500 to 20,000 kDa due to the differences in the number of subunits comprising the protein. Each subunit is approximately 250 kDa (PMID: 9759493). 

What is the tissue specificity of VWF?

The biosynthesis of VWF in vivo is limited to endothelial cells (PMID: 4209883) and megakaryocytes (PMID: 2413071). VWF synthesized in endothelial cells is either released directly into the plasma via a secretory pathway, or tubulized and stored in organelles unique to this cell type called Weibel-Palade bodies (PMID: 16459301). Whereas VWF synthesized in megakaryocytes is stored in the alpha granules of platelets (PMID: 2046403). 

What is the function of VWF?

The primary function of VWF is as an adhesive plasma glycoprotein, particularly factor VIII; an essential blood-clotting protein (PMID: 6982084). VWF is also important in platelet adhesion to wound sites by binding specifically to type I and type III collagen (PMID: 11098050), with larger VWF multimers being most effective (PMID: 24448155). 

What is the importance of post-translational modifications (PTMs) on VWF function?

During the synthesis of VWF, it must undergo extensive PTMs. The VWF monomers are subsequently N-glycosylated with the addition of a 12 N-linked high-mannose-containing oligosaccharide after the cleavage of the signal peptide in the endoplasmic reticulum. Dimerization of the pro-VWF follows glycosylation via carboxyl-termini disulphide bond formation. In the Golgi apparatus, the oligosaccharide chains are further modified into complex carbohydrates and multimerization of pro-VWF dimers occurs after another round of disulphide bond formation at the amino-termini end of the subunits (PMID: 6334089).

Protocols

Product Specific Protocols
IF protocol for VWF antibody 27186-1-APDownload protocol
IHC protocol for VWF antibody 27186-1-APDownload protocol
WB protocol for VWF antibody 27186-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratIF

Biomaterials

Oriented nanofibrous P(MMD-co-LA)/Deferoxamine nerve scaffold facilitates peripheral nerve regeneration by regulating macrophage phenotype and revascularization.

Authors - Xianzhen Dong
ratIF

Mater Today Bio

Endoscopic nasal delivery of engineered endothelial progenitor cell-derived exosomes improves angiogenesis and neurological deficits in rats with intracerebral hemorrhage

Authors - Gui Wan
humanIF

Adv Healthc Mater

Platelet Membrane-Fused Circulating Extracellular Vesicles Protect the Heart from Ischemia/Reperfusion Injury

Authors - Jizong Jiang
mouseIF

Acta Biomater

Selective inhibition of glycolysis in hepatic stellate cells and suppression of liver fibrogenesis with vitamin A-derivative decorated camptothecin micelles

Authors - Li Xiang
ratIF

Front Immunol

Fatty acid synthase inhibition improves hypertension-induced erectile dysfunction by suppressing oxidative stress and NLRP3 inflammasome-dependent pyroptosis through activating the Nrf2/HO-1 pathway

Authors - Jiaochen Luan
humanIF

Regen Biomater

Microvascular network based on the Hilbert curve for nutrient transport in thick tissue

Authors - Zhenxing Wang
Loading...
||
New chat

Able

正在加载,请稍候...