Filter: AllWBIHCIF-P

WB analysis using 60213-1-Ig (same clone as 60213-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis of human colon using 60213-1-Ig (same clone as 60213-1-PBS)
human colon tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis using 60213-1-Ig (same clone as 60213-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis of pig stomach using 60213-1-Ig (same clone as 60213-1-PBS)
pig stomach tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis of rat colon using 60213-1-Ig (same clone as 60213-1-PBS)
rat colon tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis of rat stomach using 60213-1-Ig (same clone as 60213-1-PBS)
rat stomach tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis of human stomach using 60213-1-Ig (same clone as 60213-1-PBS)
human stomach tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
WB analysis of human colon using 60213-1-Ig (same clone as 60213-1-PBS)
human colon tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 60213-1-Ig (same clone as 60213-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 60213-1-Ig (same clone as 60213-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 60213-1-Ig (same clone as 60213-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 60213-1-Ig (same clone as 60213-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 60213-1-Ig (same clone as 60213-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 60213-1-Ig (same clone as 60213-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IF Staining of mouse heart using 60213-1-Ig (same clone as 60213-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (60213-1-Ig, Clone: 2A10C2 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (60213-1-Ig, Clone: 2A10C2 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IF Staining of mouse heart using 60213-1-Ig (same clone as 60213-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.
IF Staining of mouse heart using 60213-1-Ig (same clone as 60213-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60213-1-PBS in a different storage buffer formulation.

transgelin/SM22 Monoclonal antibody, PBS Only

transgelin/SM22 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60213-1-PBS

Clone No.2A10C2

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

SM22, transgelin, 22 kDa actin-binding protein, 2A10C2, Protein WS3-10

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

60213-1-PBS targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag0764 Product name: Recombinant human TAGLN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC004927 Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Predict reactive species
Full Name	transgelin
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	18+22 kDa
GenBank Accession Number	BC004927
Gene Symbol	transgelin/SM22
Gene ID (NCBI)	6876
RRID	AB_11043177
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q01995
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells.