transgelin/SM22 Monoclonal antibody, PBS Only

transgelin/SM22 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 60213-1-PBS
Clone No.2A10C2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

SM22, transgelin, 22 kDa actin-binding protein, 2A10C2, Protein WS3-10

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60213-1-PBS targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0764

Product name: Recombinant human TAGLN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC004927

Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Predict reactive species
Full Name transgelin
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 18+22 kDa
GenBank Accession NumberBC004927
Gene Symbol transgelin/SM22
Gene ID (NCBI) 6876
RRIDAB_11043177
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01995
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells.

Loading...
||
New chat Able
正在加载,请稍候...