Tested Applications
| Positive WB detected in | HUVEC cells, HeLa cells, COLO 320 cells, A431 cells, LNCaP cells, HEK-293 cells, HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Freshly prepared samples are recommended.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66452-1-Ig targets ZO-1 in WB, IHC, IF, ELISA applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Cited Reactivity | human, pig, canine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16454 Product name: Recombinant human ZO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1446-1748 aa of BC111712 Sequence: SLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF Predict reactive species |
| Full Name | tight junction protein 1 (zona occludens 1) |
| Calculated Molecular Weight | 1748 aa, 195 kDa |
| Observed Molecular Weight | 230 kDa |
| GenBank Accession Number | BC111712 |
| Gene Symbol | ZO-1 |
| Gene ID (NCBI) | 7082 |
| RRID | AB_2881821 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q07157 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tight junction (or zonula occludens) form the continuous intercellular barrier between epithelial and endothelial cells, which is required to separate tissue spaces and regulate selective movement of solutes across the epithelium and endothelium (PMID: 20066090). ZO-1 (also known as TJP1) is a peripheral membrane phosphoprotein located on the cytoplasmic face and is expressed in tight junctions of both epithelial and endothelial cells (PMID: 3528172). It binds the transmembrane proteins occludin and the claudins linking them to cytoskeletal actin (PMID: 17418867). ZO-1 belongs to a family of multidomain proteins known as the membrane-associated guanylate kinase homologs (MAGUKs). It is a pivotal tight junction protein and may be involved in signalling mechanisms regulating cell proliferation and differentiation (PMID: 22782886).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ZO-1 antibody 66452-1-Ig | Download protocol |
| WB protocol for ZO-1 antibody 66452-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
ZO-1 Monoclonal antibody (1G4A1), catalog number 66452-1-Ig, has accumulated 123 citations. These appear in high-impact journals including Nature Communications, Cell Host & Microbe, ACS Nano, Advanced Science, Science Advances, Cell Death & Differentiation, Phytomedicine, International Journal of Molecular Sciences, and Frontiers in Pharmacology. Associated research fields span intestinal and blood-brain barrier biology, epithelial-mesenchymal transition, cancer (colorectal, gastric, lung), neuroinflammation, gut microbiota-brain axis interactions, diabetes, hepatic fibrosis, and pyroptosis.
| Species | Application | Title |
|---|---|---|
Cell Host Microbe Gut commensal Bacteroides-derived pantothenic acid alleviates metabolic syndrome. | ||
Nat Commun An electrochemical biosensor for the detection of epithelial-mesenchymal transition. | ||
Nat Commun LncRNA MIR200CHG inhibits EMT in gastric cancer by stabilizing miR-200c from target-directed miRNA degradation | ||
ACS Nano Mind the Particle Rigidity: Blooms the Bioavailability via Rapidly Crossing the Mucus Layer and Alters the Intracellular Fate of Curcumin | ||
J Adv Res Sedanolide alleviated DSS-induced colitis by modulating the intestinal FXR-SMPD3 pathway in mice | ||
Gut Microbes Gut microbiota-regulated unconjugated bilirubin metabolism drives renal calcium oxalate crystal deposition |
