WNT10B Monoclonal antibody, PBS Only

• 

  WB analysis using 67210-1-Ig (same clone as 67210-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67210-1-Ig (WNT10B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67210-1-Ig (WNT10B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67210-1-Ig (same clone as 67210-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 67210-1-Ig (WNT10B antibody), at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67210-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WNT10B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67210-1-PBS

Clone No.1G11E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1G11E4, Protein Wnt 10b, Protein Wnt 12, Protein Wnt-10b, Protein Wnt-12

---

Product Information

67210-1-PBS targets WNT10B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17114

  Product name: Recombinant human WNT10B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 19-204 aa of BC096353

  Sequence: FLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMD

• Full Name: wingless-type MMTV integration site family, member 10B
• Calculated Molecular Weight: 389 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC096353
• Gene Symbol: WNT10B
• Gene ID (NCBI): 7480
• RRID: AB_2882503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00744
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Wnt10b is a member of the Wnt ligand gene family that encodes for secreted proteins, which activate the ancient and highly conserved Wnt signalling cascade. This antibody can be detected a band of 43 kDa.