VHL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VHL Polyclonal antibody (24756-1-AP)

VHL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24756-1-AP

Publications(31)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

HRCA1, Protein G7, pVHL, RCA1, VHL, VHL1

• 

  WB analysis using 24756-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24756-1-AP (VHL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 24756-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24756-1-AP (VHL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 24756-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24756-1-AP (VHL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 24756-1-AP

  Immunofluorescent analysis of HepG2 cells using 24756-1-AP (VHL antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, Raji cells
• Positive IHC detected in: human kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24756-1-AP targets VHL in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21447

  Product name: Recombinant human VHL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-172 aa of BC058831

  Sequence: NFDGEPQPYPTLPPGTGRRIYSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

• Full Name: von Hippel-Lindau tumor suppressor
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 18-24 kDa
• GenBank Accession Number: BC058831
• Gene Symbol: VHL
• Gene ID (NCBI): 7428
• RRID: AB_2879705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40337
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has 3 isoforms with the molecular mass of 24, 20 and 18 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; AMPK-regulated glycerol excretion maintains metabolic crosstalk between reductive and energetic stress; Authors - Xuewei Zhai
human	IHC,WB	Cancer Res; Fatty Acid Oxidation Mediated by Malonyl-CoA Decarboxylase Represses Renal Cell Carcinoma Progression; Authors - Lijie Zhou
		Clin Mol Hepatol; UBE2S promotes glycolysis in hepatocellular carcinoma by enhancing E3 enzyme-independent polyubiquitination of VHL; Authors - Renyu Zhang
human	WB	Nat Commun; Hypoxia-induced downregulation of PGK1 crotonylation promotes tumorigenesis by coordinating glycolysis and the TCA cycle; Authors - Zihao Guo
human	WB	Nat Commun; Cytoplasmic TRIM24 promotes colorectal cancer cell proliferation by activating Wnt/β-catenin signaling; Authors - Ya Wang
		Nat Chem Biol; PROTAR Vaccine 2.0 generates influenza vaccines by degrading multiple viral proteins; Authors - Chunhe Zhang

Reviews

2.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Matteo (Verified Customer) (09-01-2026)

The antibody detects multiple bands. However, siRNA knockdown of VHL reduced the signal of many of these bands, suggesting that the antibody is relatively specific. That said, it can be difficult to interpret the results without an appropriate control.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: CAL51

VHL Antibody Western Blot validation (1:500 dilution) in CAL51 (Cat no:24756-1-AP)

S (Verified Customer) (11-22-2021)

This antibody didn't work in my hands. There are too many non-specific bands to identify the VHL band.

• Applications: Western Blot

VHL Antibody Western Blot validation ( dilution) in (Cat no:24756-1-AP)