Product Information
83572-4-PBS targets VEGFA164 in Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Eg0277 Product name: Recombinant Mouse VEGFA protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 27-190 aa of NM_001287057 Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Predict reactive species | 
                                    
| Full Name | vascular endothelial growth factor A | 
| Calculated Molecular Weight | 22kd | 
| GenBank Accession Number | NM_001287057 | 
| Gene Symbol | Vegfa | 
| Gene ID (NCBI) | 22339 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q00731-2 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
