USP6NL Polyclonal antibody

• 

  WB analysis using 30440-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30440-1-AP (USP6NL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30440-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30440-1-AP (USP6NL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 30440-1-AP

  WB result of USP6NL antibody (30440-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP6NL transfected HeLa cells.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 30440-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 30440-1-AP (USP6NL antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 30440-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 30440-1-AP (USP6NL antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

USP6NL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30440-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

USP6 N-terminal-like protein, Related to the N-terminus of tre, KIAA0019

---

Tested Applications

• Positive WB detected in: HT-29 cells, HeLa cells, SW480 cells, Jurkat cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30440-1-AP targets USP6NL in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32603

  Product name: Recombinant human USP6NL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC042943

  Sequence: MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRD

• Full Name: USP6 N-terminal like
• Calculated Molecular Weight: 828 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC042943
• Gene Symbol: USP6NL
• Gene ID (NCBI): 9712
• RRID: AB_3086315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92738
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP6NL, also named RN-tre, is a GTPase-activating protein (GAP), which stimulates GTP hydrolysis on various members of the Rab family, thereby inhibiting endocytosis of PM receptors and retrograde Golgi transport. It is highly expressed in many cancer types and may promote the growth and proliferation of cancer cells.