Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

p115, USO1 Polyclonal antibody

p115, USO1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

USO1, General vesicular transport factor p115, Protein USO1 homolog, TAP, Transcytosis-associated protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for p115, USO1 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, human brain tissue, mouse brain tissue, mouse testis tissue, mouse thymus tissue, SH-SY5Y cells, HepG2 cells, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman lung cancer tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13509-1-AP targets p115, USO1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4431

Product name: Recombinant human p115, USO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 660-961 aa of BC032654

Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

Predict reactive species
Full Name USO1 homolog, vesicle docking protein (yeast)
Calculated Molecular Weight 962 aa, 108 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC032654
Gene Symbol USO1
Gene ID (NCBI) 8615
RRIDAB_2257094
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60763
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

p115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479).

Protocols

Product Specific Protocols
IF protocol for p115, USO1 antibody 13509-1-APDownload protocol
IHC protocol for p115, USO1 antibody 13509-1-APDownload protocol
IP protocol for p115, USO1 antibody 13509-1-APDownload protocol
WB protocol for p115, USO1 antibody 13509-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The p115/USO1 polyclonal antibody (Cat# 13509-1-AP) has 29 citations spanning journals including Science, Nature Communications, Molecular Cell, EMBO Journal, Journal of Cell Biology, FASEB Journal, J Virol, and eLife. Research fields cover Golgi apparatus organization and biogenesis, vesicular transport, cell polarity, stem cell function, viral infections (HCMV, HSV-1, enterovirus), autophagy, insulin trafficking, ferroptosis, inflammation, blood-brain barrier integrity, skeletal muscle differentiation, and acrosome biogenesis.

SpeciesApplicationTitle

Science

Atlas of lysosomal aging reveals a metabolite signature shared with lysosomal storage disorders.

Authors - Anna M. Puszynska
humanIF

Nat Commun

AmotL2 disrupts apical-basal cell polarity and promotes tumour invasion.

Authors - Mahdi Mojallal

Nat Commun

Golgi organization regulates stem cell function in the small intestine.

Authors - Ilya Belevich
humanWB,IF

Mol Cell

An mTORC1-GRASP55 signaling axis controls unconventional secretion to reshape the extracellular proteome upon stress.

Authors - Julian Nüchel
mouseIF

Cell Death Dis

Globozoospermia and lack of acrosome formation in GM130-deficient mice.

Authors - Feng Han
humanIF

EMBO J

A coordinated transcriptional program controls de novo Golgi biogenesis.

Authors - Francesca Forno
Loading...
||
New chat

Able™

正在加载,请稍候...