Use Able AI chat for product recommendations

UBE2D1/2/3/4 Polyclonal antibody

UBE2D1/2/3/4 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

E2(17)KB3, UBC4/5, UBC5C, UBCH5C, UBE2D1, UBE2D1/2/3/4, UBE2D2, UBE2D3, UBE2D4, Ubiquitin carrier protein D3, Ubiquitin protein ligase D3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for UBE2D1/2/3/4 in ?

Tested Applications

Positive WB detected inHEK-293 cells, mouse brain tissue, Hela cells, Jurkat cells, rat brain tissue, mouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11677-1-AP targets UBE2D1/2/3/4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2278

Product name: Recombinant human UBE2D3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC003395

Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC003395
Gene Symbol UBE2D3
Gene ID (NCBI) 7323
RRIDAB_2256691
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP61077
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Protocols

Product Specific Protocols
IHC protocol for UBE2D1/2/3/4 antibody 11677-1-APDownload protocol
WB protocol for UBE2D1/2/3/4 antibody 11677-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-UBE2D3 antibody (Cat# 11677-1-AP) has 14 citations published in journals including Cell Research, Nature Communications, Molecular Cell, Cell Death Discovery, Arthritis & Rheumatology, Science Signaling, Oncotarget, and mSphere. Research fields span cancer biology (hepatocellular carcinoma, esophageal cancer, glioblastoma, breast cancer), ubiquitination, immune evasion, epigenetics, mTOR signaling, VEXAS syndrome, and virology (SARS-CoV-2). Applications include WB and IHC across human, mouse, hamster, and Drosophila species.

SpeciesApplicationTitle

Cell Res

Tumor PD-L1 induces β2m ubiquitylation and degradation for cancer cell immune evasion.

Authors - Qiuling Zhao
mouseWB

Nat Commun

UBE2D3 facilitates NHEJ by orchestrating ATM signalling through multi-level control of RNF168

Authors - Zeliha Yalçin
  • KD Validated
humanWB

Nat Commun

Clr4SUV39H1 ubiquitination and non-coding RNA mediate transcriptional silencing of heterochromatin via Swi6 phase separation

Authors - Hyun-Soo Kim
humanWB

Mol Cell

Ring domains are essential for GATOR2-dependent mTORC1 activation

Authors - Cong Jiang
humanWB

Cell Death Discov

Aberrant activation of a miR-101-UBE2D1 axis contributes to the advanced progression and chemotherapy sensitivity in human hepatocellular carcinoma

Authors - Xiuli Mu
hamsterWB

Arthritis Rheumatol

Novel somatic UBA1 variant in a patient with VEXAS syndrome

Authors - Blanka Stiburkova
Loading...
||
New chat

Able™

正在加载,请稍候...