TWIST1 Polyclonal antibody

• 

  WB analysis of PC-3 using 18125-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 18125-1-AP (TWIST1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 18125-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18125-1-AP (TWIST1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 18125-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 18125-1-AP (TWIST1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 18125-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 18125-1-AP (TWIST1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

TWIST1 Polyclonal Antibody for WB, ELISA

Cat No. 18125-1-AP

Publications(19)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, IHC, ELISA

Synonyms

ACS3, bHLHa38, BPES2, BPES3, H twist, SCS, TWIST, twist homolog 1 (Drosophila), Twist related protein 1, TWIST1

---

Tested Applications

• Positive WB detected in: PC-3 cells, MCF-7 cells, SGC-7901 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 17 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

18125-1-AP targets TWIST1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12700

  Product name: Recombinant human TWIST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-202 aa of BC036704

  Sequence: MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

• Full Name: twist homolog 1 (Drosophila)
• Calculated Molecular Weight: 202 aa, 21 kDa
• Observed Molecular Weight: 22 kDa, 28 kDa, 45-60 kDa
• GenBank Accession Number: BC036704
• Gene Symbol: TWIST1
• Gene ID (NCBI): 7291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15672
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TWIST1, a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. It is also implicated in tumorigenesis, invasion and metastasis. TWIST1 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IHC,IF	Theranostics; Twist1 downregulation of PGC-1α decreases fatty acid oxidation in tubular epithelial cells, leading to kidney fibrosis.; Authors - Limin Liu
human	WB	Int J Biochem Cell Biol; Blue light emitting diodes irradiation causes cell death in colorectal cancer by inducing ROS production and DNA damage.; Authors - Gege Yan
human	WB	Cancer Lett; Downregulation of ACE2/Ang-(1-7)/Mas axis promotes breast cancer metastasis by enhancing store-operated calcium entry.; Authors - Changhui Yu
human	WB,IHC	Int J Cancer; Down-regulation of KIAA1199/CEMIP by miR-216a suppresses tumor invasion and metastasis in colorectal cancer.; Authors - Dejun Zhang
human	WB	Sci Rep; Correlations between TBL1XR1 and recurrence of colorectal cancer.; Authors - Hongda Liu
mouse	WB	Sci Rep; Conditional ablation of TGF-β signaling inhibits tumor progression and invasion in an induced mouse bladder cancer model.; Authors - Yu Liang