TUSC3 Polyclonal antibody

• 

  WB analysis of HeLa using 16039-1-AP

  WB result of TUSC3 antibody (16039-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-TUSC3 transfected HeLa cells.

• 

  WB analysis using 16039-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16039-1-AP (TUSC3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 16039-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 16039-1-AP (TUSC3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TUSC3 Polyclonal Antibody for WB, ELISA

Cat No. 16039-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

M33, MRT7, N33, OST3A, Protein N33, tumor suppressor candidate 3, TUSC3

---

Tested Applications

• Positive WB detected in: HeLa cells, rat testis tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 5 publications below
• IHC: See 2 publications below

Product Information

16039-1-AP targets TUSC3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8912

  Product name: Recombinant human TUSC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-199 aa of BC010370

  Sequence: KENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYS

• Full Name: tumor suppressor candidate 3
• Calculated Molecular Weight: 347 aa, 40 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC010370
• Gene Symbol: TUSC3
• Gene ID (NCBI): 7991
• RRID: AB_2878208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13454
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TUSC3 (tumor suppressor candidate 3), originally named N33, is a potential tumor supressor gene. Decreased expression of TUSC3 has been found in various cancers, including prostate cancer, pancreas cancer and ovary cancer. TUSC3 also known as OST3A, is identified as a part of the oligosaccharyl-transferase (OST) complex and plays a crucial role in protein N-glycosylation. TUSC3 mutations have been found in families with non-syndromic autosomal recessive mental retardation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Commun; miRNA-mediated TUSC3 deficiency enhances UPR and ERAD to promote metastatic potential of NSCLC.; Authors - Young-Jun Jeon
human	WB	J Cell Biol; Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.; Authors - Natalia A Cherepanova ; KD Validated
human	WB	Sci Rep; Mammalian cells lacking either the cotranslational or posttranslocational oligosaccharyltransferase complex display substrate-dependent defects in asparagine linked glycosylation.; Authors - Natalia A Cherepanova ; KD Validated
human	WB	J Biol Chem; ER entry pathway and glycosylation of GPI-anchored proteins are determined by N-terminal signal sequence and C-terminal GPI-attachment sequence; Authors - Tetsuya Hirata
human	IHC	J Transl Med; Downregulation of TUSC3 promotes EMT and hepatocellular carcinoma progression through LIPC/AKT axis; Authors - Ruxia Deng ; KD Validated
human	WB	J Allergy Clin Immunol; Epigenetic activation of the TUSC3 gene as a potential therapy for XMEN disease; Authors - Haodong Ding