• Featured Product
  • KD/KO Validated

TULP3 Polyclonal antibody

TULP3 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 13637-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Tubby-like protein 3, Tubby-related protein 3, TUBL3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, SH-SY5Y cells, HeLa cells, SK-N-SH cells
Positive IP detected inSH-SY5Y cells
Positive IHC detected inhuman ovary cancer tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13637-1-AP targets TULP3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4570

Product name: Recombinant human TULP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 96-442 aa of BC032587

Sequence: DEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE

Predict reactive species
Full Name tubby like protein 3
Calculated Molecular Weight 442 aa, 50 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC032587
Gene Symbol TULP3
Gene ID (NCBI) 7289
RRIDAB_2211547
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75386
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The tubby-like protein 3 (TULP3) has been identified as a member of tubby and tubby-like proteins (TULPs) that plays an important role in maintenance and function of neuronal cells during development and post-differentiation. Tulp3 gene is essential for embryonic development in mice. Recently TULP3 has been reported to bind to the IFT (intraflagellar transport)-A complex and promote trafficking of G protein-coupled receptors into primary cilia, which is implicated in regulating neuronal function.

Protocols

Product Specific Protocols
WB protocol for TULP3 antibody 13637-1-APDownload protocol
IHC protocol for TULP3 antibody 13637-1-APDownload protocol
IP protocol for TULP3 antibody 13637-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Sci Adv

Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ.

Authors - Chuan Chen
humanWB,IF

Elife

Multiple ciliary localization signals control INPP5E ciliary targeting

Authors - Dario Cilleros-Rodriguez
mouseWB

PLoS Genet

Zfp423 Regulates Sonic Hedgehog Signaling via Primary Cilium Function.

Authors - Chen-Jei Hong
  • KD Validated
humanWB

J Neurosci

Comparison of ciliary targeting of two rhodopsin-like GPCRs: role of C-terminal localization sequences in relation to cilium type.

Authors - Abhishek Chadha
  • KO Validated
humanWB

J Cell Sci

RABL2 positively controls localization of GPCRs in mammalian primary cilia.

Authors - Izumi Dateyama
mouseIF

J Biol Chem

Deletion of the phosphatase INPP5E in the murine retina impairs photoreceptor axoneme formation and prevents disc morphogenesis.

Authors - Ali S Sharif

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Evan (Verified Customer) (09-30-2019)

One of the worst antibodies I have ever used. I do not believe this antibody accurately detects Tulp3 by western blotting at all. The amount of non-specific bands at all sizes is so bad this antibody is pretty much only good for a protein stain. I have wasted weeks trying to get this antibody to work to no avail. Avoid this product for western blotting at all costs.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HEK293T
FH

Francesc (Verified Customer) (09-19-2018)

We previously described that TULP3 (a PIP2-binding protein) accumulates in INPP5E-KO cilia, which also accumulate PIP2 (Garcia-Gonzalo et al. 2015 Dev Cell 34:400-409). We have successfully confirmed those results using Proteintech's anti-TULP3 antibody (13637-1-AP) in both mouse embryonic fibroblasts (MEFs, see my previous review) and in hTERT-RPE1 cells (here). This TULP3 antibody works beautifully, especially in human cells (it also works well in MEFs, but ciliary signal is less intense and lower dilution is needed). As far as I know, this is the best commercial anti-TULP3 available.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: hTERT-RPE1 cells (human origin)
TULP3 Antibody Immunofluorescence, validation (1/200 dilution) in hTERT-RPE1 cells (human origin) (Cat no:13637-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...