TRPV6 Polyclonal antibody

• 

  WB analysis using 31045-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31045-1-AP (TRPV6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

TRPV6 Polyclonal Antibody for WB, ELISA

Cat No. 31045-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

ABP/ZF, Calcium transport protein 1, CaT L, CaT like, CAT1, CATL, ECAC2, Epithelial calcium channel 2, HSA277909, LP6728, TRPV6, ZFAB

---

Tested Applications

• Positive WB detected in: PC-3 cells, human placenta tissue, mouse brain tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

31045-1-AP targets TRPV6 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34052

  Product name: Recombinant human TRPV6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 670-765 aa of NM_018646

  Sequence: FLRVEDRQDLNRQRIQRYAQAFHTRGSEDLDKDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI*

• Full Name: transient receptor potential cation channel, subfamily V, member 6
• Calculated Molecular Weight: 87KD
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_018646
• Gene Symbol: TRPV6
• Gene ID (NCBI): 55503
• RRID: AB_3669830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1D0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nanobiotechnology; Ultrasound-triggered piezoelectric polyetheretherketone with boosted osteogenesis via regulating Akt/GSK3β/β-catenin pathway; Authors - Yue Li