• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TOM20 Polyclonal antibody

TOM20 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11802

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

TOMM20, KIAA0016, MAS20, MOM19, tom 20

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHUVEC cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 5 publications below

Product Information

CL488-11802 targets TOM20 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2378

Product name: Recombinant human TOM20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-145 aa of BC000882

Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Predict reactive species
Full Name translocase of outer mitochondrial membrane 20 homolog (yeast)
Calculated Molecular Weight 145 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC000882
Gene Symbol TOM20
Gene ID (NCBI) 9804
RRIDAB_2919040
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15388
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Background

 TOM20 (KIAA0016) belongs to the Tom family. It is a subunit of the mitochondrial import receptor (PMID: 7584026), whose main role is to translocate cytosolically synthesized mitochondrial proteins through the outer mitochondrial membrane and subsequently facilitate the movement of proteins into the TOM40 translocation pore complex (PMID: 21173275).

 What is the molecular weight of TOM20? 

 It is a short 16.3 kDa protein containing several highly conserved regions, including the transmembrane segment, the ligand-binding domain, and flexible segments at the N terminus and the C terminus of the protein crucial for its function (PMID: 15733919).

 What is the subcellular localization of TOM20?

 It specifically localizes in the mitochondrial outer membrane. In malignant cells, strong granular staining in the cytoplasm has been observed.

 What is the tissue specificity of TOM20?

 It is ubiquitously expressed in various tissues, with a particularly high expression in the brain, thyroid, and pancreas.

 What is the function of TOM20 in the mitochondrial membrane?

 Mitochondrial preproteins are generally synthesized in the cytoplasm with signal or targeting sequences, which are recognized by specific receptors on the outer mitochondrial membrane. TOM20, as one of the components of the TOM40 complex, specifically recognizes pre-sequences on target proteins or their unfolded forms. In addition to its translocase activity, TOM20 may act as a chaperone preventing these proteins from aggregation at the surface of mitochondria (PMID: 14699115).

 What is TOM20's involvement in disease?

 Diseases linked to the misregulation of TOM20 include Perry Syndrome and neurodegeneration with brain iron accumulation 2A. Numerous studies also associate deregulation of TOM20 with an array of mitochondrial dysfunctions and mitophagy defects (PMIDs: 30254015, 30160596). 


Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TOM20 antibody CL488-11802Download protocol
IF protocol for CL Plus 488 TOM20 antibody CL488-11802Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Free Radic Biol Med

Loss of the redox mitochondrial protein mitoNEET leads to mitochondrial dysfunction in B-cell acute lymphoblastic leukemia.

Authors - Werner J Geldenhuys
humanIF

bioRxiv

HTLV-1 Tax induces PINK1-Parkin-dependent mitophagy to mitigate activation of the cGAS-STING pathway

Authors - Suchitra Mohanty
mouseIF

bioRxiv

Integrated spatial transcriptomics and lipidomics of precursor lesions of pancreatic cancer identifies enrichment of long chain sulfatide biosynthesis as an early metabolic alteration

Authors - Marta Sans
mouseIF

Biol Direct

Reprogramming hematopoietic stem cell metabolism in lung cancer: glycolysis, oxidative phosphorylation, and the role of 2-DG

Authors - Ziqi Guo
humanIF

iScience

Lipopolysaccharide induces placental mitochondrial dysfunction in murine and human systems by reducing MNRR1 levels via a TLR4-independent pathway

Authors - Neeraja Purandare

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Eden (Verified Customer) (08-01-2025)

HeLa cells were fixed with 4% formaldehyde and 0.02% glutaraldehyde. The antibody was diluted 1:1000 in 3% BSA in PBS. Works well!

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa cells
CL Plus 488 TOM20 Antibody Immunofluorescence validation (1:1000 dilution) in HeLa cells (Cat no:CL488-11802)
Loading...
||
New chat Able
正在加载,请稍候...