Tested Applications
| Positive IHC detected in | human kidney tissue, mouse lung tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 10 publications below |
| IF | See 2 publications below |
Product Information
17353-1-AP targets TIMP2 in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10051 Product name: Recombinant human TIMP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 6-220 aa of BC052605 Sequence: RTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP Predict reactive species |
| Full Name | TIMP metallopeptidase inhibitor 2 |
| Calculated Molecular Weight | 220 aa, 24 kDa |
| GenBank Accession Number | BC052605 |
| Gene Symbol | TIMP2 |
| Gene ID (NCBI) | 7077 |
| RRID | AB_2287495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16035 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The TIMPs are natural highly specific endogenous inhibitors of MMPs. Human TIMP family consists of four 21-28 kDa proteins known as TIMP1, TIMP2, TIMP3, and TIMP4 encoded by four paralogous genes.TIMPs are vital to the maintenance of ECM homeostasis primarily through their MMP inhibitory functions. TIMP2, a member of the TIMP family, regulates the proteolytic activity of all MMPs and is involved in cell differentiation, growth, migration, angiogenesis, and apoptosis. Urinary TIMP2 has been recently recognized as an early biomarker to predict Acute kidney injury (AKI) in critically ill patients.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TIMP2 antibody 17353-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Cancer Res RAB37 Hypermethylation Regulates Metastasis and Resistance to Docetaxel-Based Induction Chemotherapy in Nasopharyngeal Carcinoma. | ||
Cell Death Dis α1,3-fucosylation of MEST promotes invasion potential of cytotrophoblast cells by activating translation initiation | ||
Int J Mol Sci PTEN Inhibitor Treatment Lowers Muscle Plasma Membrane Damage and Enhances Muscle ECM Homeostasis after High-Intensity Eccentric Exercise in Mice | ||
Int J Biol Sci TDG suppresses the migration and invasion of human colon cancer cells via the DNMT3A/TIMP2 axis. | ||
Invest Ophthalmol Vis Sci Quercetin Alleviates Scleral Remodeling Through Inhibiting the PERK-EIF2α Axis in Experiment Myopia | ||
Mar Drugs 11-epi-Sinulariolide Acetate Reduces Cell Migration and Invasion of Human Hepatocellular Carcinoma by Reducing the Activation of ERK1/2, p38MAPK and FAK/PI3K/AKT/mTOR Signaling Pathways. |









