TCERG1L Polyclonal antibody

• 

  IHC staining of mouse testis using 20858-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20858-1-AP (TCERG1L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 20858-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20858-1-AP (TCERG1L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 20858-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using TCERG1L antibody (20858-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

TCERG1L Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 20858-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

Transcription elongation regulator 1-like protein

---

Tested Applications

• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20858-1-AP targets TCERG1L in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14828

  Product name: Recombinant human TCERG1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 337-545 aa of BC042951

  Sequence: DLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNRTEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEKSKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNKFILILKKRDKENRLRLRKMR

• Full Name: transcription elongation regulator 1-like
• Calculated Molecular Weight: 586 aa, 66 kDa
• GenBank Accession Number: BC042951
• Gene Symbol: TCERG1L
• Gene ID (NCBI): 256536
• RRID: AB_3085624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWI1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCERG1L, Transcription elongation regulator 1-like protein, is associated with plasma adiponectin, and plasma adiponectin is a key modulator of obesity, inflammation, IR and diabetes (PMID:22791750). Gene silencing of FBN2 and TCERG1L is associated with promoter DNA hypermethylation in CRC tumors and may be biomarkers for the early detection of CRC (PMID:22238052). Stra8 and TCERG1L play a role in retinoic acid induced spermatogonial differentiation in mouse (PMID:3395975).