CoraLite® Plus 488-conjugated TAU Polyclonal antibody

TAU Polyclonal Antibody for IF-P
Cat No. CL488-10274

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

DDPAC, FLJ31424, FTDP 17, MAPT, MAPTL, MSTD, MTBT1, MTBT2, Neurofibrillary tangle protein, Paired helical filament tau, PHF tau, PPND, TAU

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10274 targets TAU in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0354

Product name: Recombinant human TAU protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 5-208 aa of BC000558

Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL

Predict reactive species
Full Name microtubule-associated protein tau
Calculated Molecular Weight 37-46, 79-81 kDa
Observed Molecular Weight 45-70 kDa, 100 kDa
GenBank Accession NumberBC000558
Gene Symbol TAU
Gene ID (NCBI) 4137
RRIDAB_3083869
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10636
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tau (tubulin-associated unit) is a microtubule-associated protein (also known as MAPT), expressed mainly in neurons of the central nervous system. Its primary function is to modulate microtubule dynamics for maintaining axonal cytoskeleton. Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (8752131,15965697). Present polyclonal anti-Tau antibody was produced by immunizing animals with N-terminal of Tau and can detect approx 45-70 kDa and 100-kDa bands in brain tissues.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TAU antibody CL488-10274Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...