Tested Applications
| Positive WB detected in | HCT 116 cells, HepG2 cells, mouse skeletal muscle tissue, HeLa cells, mouse spleen tissue, SW480 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 20 publications below |
| IHC | See 13 publications below |
| IF | See 7 publications below |
| IP | See 3 publications below |
| RIP | See 1 publications below |
Product Information
11114-1-AP targets TAP1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1619 Product name: Recombinant human TAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 509-808 aa of BC014081 Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE Predict reactive species |
| Full Name | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) |
| Calculated Molecular Weight | 81 kDa |
| Observed Molecular Weight | 70-81 kDa |
| GenBank Accession Number | BC014081 |
| Gene Symbol | TAP1 |
| Gene ID (NCBI) | 6890 |
| RRID | AB_2200201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03518 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70-80 kDa in HeLa cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAP1 antibody 11114-1-AP | Download protocol |
| IHC protocol for TAP1 antibody 11114-1-AP | Download protocol |
| IP protocol for TAP1 antibody 11114-1-AP | Download protocol |
| WB protocol for TAP1 antibody 11114-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology microRNA 125a Regulates MHC-I Expression on Esophageal Adenocarcinoma Cells, Associated With Suppression of Antitumor Immune Response and Poor Outcomes of Patients. | ||
Nat Commun Proteomic analysis of archival breast cancer clinical specimens identifies biological subtypes with distinct survival outcomes. | ||
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
Theranostics Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. | ||
Int J Cancer Antitumor efficacy of intermittent low-dose erlotinib plus sulindac via MHC upregulation and remodeling of the immune cell niche | ||
Int J Mol Sci Antigen Peptide Transporter 1 (TAP1) Promotes Resistance to MEK Inhibitors in Pancreatic Cancers. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Adrianna (Verified Customer) (10-24-2022) | This antibody is excellent. I've tried anti TAP1 antibodies from different companies and they all showed brighter bands for contaminants than the TAP1 protein, here I can clearly see my protein of interest.
|

















