Tested Applications
Positive WB detected in | A375 cells, HEK-293T cells, NIH/3T3 cells, HCT 116 cells, HeLa cells, K-562 cells |
Positive IHC detected in | human colon cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 3 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
27566-1-AP targets TAB1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25576 Product name: Recombinant human MAP3K7IP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-504 aa of BC050554 Sequence: TSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP Predict reactive species |
Full Name | mitogen-activated protein kinase kinase kinase 7 interacting protein 1 |
Calculated Molecular Weight | 55 kDa |
Observed Molecular Weight | 55 kDa |
GenBank Accession Number | BC050554 |
Gene Symbol | TAB1 |
Gene ID (NCBI) | 10454 |
RRID | AB_2880910 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15750 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TAB1 antibody 27566-1-AP | Download protocol |
IHC protocol for TAB1 antibody 27566-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci MicroRNA-27a-5p Downregulates Expression of Proinflammatory Cytokines in Lipopolysaccharide-Stimulated Human Dental Pulp Cells via the NF-κB Signaling Pathway
|