ChromoTek Strep-NanoTrap Agarose Kit

The ChromoTek Strep-NanoTrap Agarose Kit consists of an anti-Strep-tag® Nanobody/VHH, which is coupled to agarose beads. It also contains lysis, wash, and elution buffers that can be used for the immunoprecipitation of Strep-tagged proteins from cell extracts of various organisms.

Specificity

Strep-Tag® (sequence: SAWSHPQFEK) and Twin-Strep-Tag® (sequence: SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK)

Applications

IP, Co-IP

Type

Nanobody

Conjugate

Agarose

Cat no : qtak

Synonyms

Strep Trap, SAWSHPQFEK-Trap, Strep-tag-Trap

---

Validation Data Gallery

• 

  IP of StrepTag-Aurora Kinase B fusion protein from transfected HEK293T cells using either Strep-NanoTrap Agarose (left) or a Competitor Resin (right). The Strep-NanoTrap binds with higher affinity to the strep-tagged protein in comparison to the competitor product. I: Input, F: Flow-Through, B: Bound.

• 

  Co-IP using Strep-NanoTrap Agarose followed by multiplexed WB of StrepTag-AurKinB, CDC37, and HSP090AB1 proteins from untransfected (mock) HEK293T cells and HEK293T cells transfected with StrepTag-Aurora Kinase B construct. WB analysis was done on samples from the Input (I), Flow-through (F) and Bound (B) fractions of the IP. For the WB analysis, StrepTag was detected using an Anti-StrepTag DY-649 antibody, CDC37 was detected with an Anti-CDC37 Monoclonal Antibody (66420-1-Ig) labeled with FlexAble CoraLite Plus 750 Antibody Labeling Kit for Mouse IgG2a (KFA044), and HSP90AB1 was detected using an Anti-HSP90AB1 Monoclonal Antibody (67450-1-Ig) labeled with FlexAble CoraLite Plus 488 Antibody Labeling Kit for Mouse IgG2b (KFA061).

• 

  IP followed by WB of either N- (left) or C- (right) terminally-linked TwinStrepTag-Aurora Kinase B fusion proteins from transfected HEK293T cells using either Strep-NanoTrap Agarose or a Competitor Resin. The Strep-NanoTrap binds to both N- and C-terminally linked TwinStrepTag proteins with higher affinity than the competitor product. WB analysis additionally indicates that all TwinStrepTagged material is sucessfully eluted in the Bound (B) fraction, with little to no material left in the Flow-Through (F).

---

Product Information

The ChromoTek Strep-NanoTrap Agarose Kit consists of an anti-Strep-tag® Nanobody/VHH, which is coupled to agarose beads. It also contains lysis, wash, and elution buffers that can be used for the immunoprecipitation of Strep-tagged proteins from cell extracts of various organisms.

• Description: The Strep-Trap Agarose Kit contains Strep-Trap agarose, lysis, wash, and elution buffers for efficient immunoprecipitation of Strep-tagged proteins.;

  • Fast, reliable & efficient one-step immunoprecipitation;

  • Ready-to-use;

  • No heavy & light antibody chains;

  • Stable under harsh washing conditions;

  • Suitable for downstream mass spec analysis;

• Applications: IP, Co-IP
• Specificity/Target: Binds specifically to the peptide sequence SAWSHPQFEK, also known as ; Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this trap binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as ; Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position.
• Binding Capacity: 25 ug of recombinant SAWSHPQFEK-tagged protein (~30 kDa) per 25 uL bead slurry
• Conjugate: Agarose beads; ~90 um (cross-linked 4% agarose beads)
• Elution buffer: 2x SDS-sample buffer (Lammli)
• Wash Buffer Compatibility: 1M NaCl, 5 mM DTT, 5 mM β-mercaptoethanol, 5 mM TCEP, 2% NP40, 2% Triton X-100, 0.1% SDS, 2-3 M Urea
• Type: Nanobody
• Class: Recombinant
• Host: Alpaca
• Affinity (KD): 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag®
• Compatibility with mass spectrometry: The Strep-Trap is optimized for on-bead digestion. For the application note, please click here:; On-bead digest protocol for mass spectrometry
• RRID: AB_3107051
• Storage Buffer: 20% ethanol
• Storage Condition: Shipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. DO not freeze!

Kit components

Component	Description
Strep-NanoTrap Agarose	20 reactions (500 µl)
Lysis buffer	Optimized for cytoplasmic proteins and mammalian cell lysis
RIPA buffer	Optimized for nuclear/chromatin proteins and mammalian cell lysis
Wash buffer	Removal of unwanted proteins, peptides, etc.
Dilution buffer	Dilution of cell lysate
Elution buffer	For acidic elution

Other Formats

Strep-NanoTrap Agarose