Validation Data Gallery
Product Information
The ChromoTek Strep-NanoTrap Agarose Kit consists of an anti-Strep-tag® Nanobody/VHH, which is coupled to agarose beads. It also contains lysis, wash, and elution buffers that can be used for the immunoprecipitation of Strep-tagged proteins from cell extracts of various organisms.
| Description | The Strep-Trap Agarose Kit contains Strep-Trap agarose, lysis, wash, and elution buffers for efficient immunoprecipitation of Strep-tagged proteins. • Fast, reliable & efficient one-step immunoprecipitation • Ready-to-use • No heavy & light antibody chains • Stable under harsh washing conditions • Suitable for downstream mass spec analysis |
| Applications | IP, Co-IP |
| Specificity/Target | Binds specifically to the peptide sequence SAWSHPQFEK, also known as Strep-Tag® or Strep-TagII®, fused to a protein of interest at N- or C-terminal position. In addition, this trap binds to the peptide sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, also known as Twin-Strep-Tag®, fused to a protein of interest at N- or C-terminal position. |
| Binding Capacity | 25 ug of recombinant SAWSHPQFEK-tagged protein (~30 kDa) per 25 uL bead slurry |
| Conjugate | Agarose beads; ~90 um (cross-linked 4% agarose beads) |
| Elution buffer | 2x SDS-sample buffer (Lammli) |
| Wash Buffer Compatibility | 1M NaCl, 5 mM DTT, 5 mM β-mercaptoethanol, 5 mM TCEP, 2% NP40, 2% Triton X-100, 0.1% SDS, 2-3 M Urea |
| Type | Nanobody |
| Class | Recombinant |
| Host | Alpaca |
| Affinity (KD) | 480 nM for N-terminal Strep-Tag® and 600 nM for C-terminal Strep-Tag® |
| Compatibility with mass spectrometry | The Strep-Trap is optimized for on-bead digestion. For the application note, please click here: On-bead digest protocol for mass spectrometry |
| RRID | AB_3107051 |
| Storage Buffer | 20% ethanol |
| Storage Condition | Shipped at ambient temperature. Upon receipt store at +4°C. Stable for one year. DO not freeze! |
Kit components
| Component | Description |
|---|---|
| Strep-NanoTrap Agarose | 20 reactions (500 µl) |
| Lysis buffer | Optimized for cytoplasmic proteins and mammalian cell lysis |
| RIPA buffer | Optimized for nuclear/chromatin proteins and mammalian cell lysis |
| Wash buffer | Removal of unwanted proteins, peptides, etc. |
| Dilution buffer | Dilution of cell lysate |
| Elution buffer | For acidic elution |
Documentation
| SDS |
|---|
| qtak_SDS_HA-Trap Agarose Kit (EN) |
| Datasheet |
|---|
| Strep-NanoTrap Agarose, Kit for Immunoprecipitation Datasheet |


